UCOOK: Healthy Ideas
  • Recipes
    Potato roti (no flour) 8+ months baby. #babyfood #semisolids #rotiforbabies #healthyrecipes Potato roti (no flour) 8+ months baby. #babyfood #semisolids #rotiforbabies #healthyrecipes
    February 19, 2026
    healthy breakfast besan chilla#breakfast#healthy  #cookingshorts#food#nashta#cooking#recipe #shorts healthy breakfast besan chilla#breakfast#healthy #cookingshorts#food#nashta#cooking#recipe #shorts
    February 19, 2026
    Sundakkai Thuvaiyal #sundakkai #healthyrecipes #health #cook #food #shorts Sundakkai Thuvaiyal #sundakkai #healthyrecipes #health #cook #food #shorts
    February 19, 2026
    Triple ABC Juice Recipe By Dr Manisha #shorts #glowingskin #hair #abcjuice Triple ABC Juice Recipe By Dr Manisha #shorts #glowingskin #hair #abcjuice
    February 19, 2026
    Simple Methi Dal Recipe | Fenugreek Leaves Dal | Healthy Homemade Village Style Cooking Simple Methi Dal Recipe | Fenugreek Leaves Dal | Healthy Homemade Village Style Cooking
    February 19, 2026
    Previous Next
  • Breakfast
    Healthy Breakfast | breakfast ideas | easy breakfast | quick breakfast recipe Healthy Breakfast | breakfast ideas | easy breakfast | quick breakfast recipe
    February 20, 2026
    Ragi Dosa| Weightloss Recipe| Healthy Breakfast #recipe #breakfast #shorts #food #healthy #yummy Ragi Dosa| Weightloss Recipe| Healthy Breakfast #recipe #breakfast #shorts #food #healthy #yummy
    February 19, 2026
    High Protein Moong Chilla | Mung Beans Chilla #healthy #breakfast #recipe #food #shorts High Protein Moong Chilla | Mung Beans Chilla #healthy #breakfast #recipe #food #shorts
    February 19, 2026
    How To Make Healthy Overnight Oats | Light Breakfast Recipe How To Make Healthy Overnight Oats | Light Breakfast Recipe
    February 19, 2026
    Busy Morning! Looking for an Easy & Quick Veg Breakfast? Try This Healthy Vegetarian Snacks Recipe Busy Morning! Looking for an Easy & Quick Veg Breakfast? Try This Healthy Vegetarian Snacks Recipe
    February 19, 2026
    Previous Next
  • Lunch
    Healthy Lunch Thali #lunchideas #indianfood #viral #shorts Healthy Lunch Thali #lunchideas #indianfood #viral #shorts
    February 19, 2026
    Acharya Manish's SECRET Vitamin B12 Rich Recipe! #shorts #easyrecipe #food #facts Acharya Manish’s SECRET Vitamin B12 Rich Recipe! #shorts #easyrecipe #food #facts
    February 19, 2026
    Benefits of sabudana By Dr Bimal chhajer ji #sabudana#healthy #food #recipe#cooking #viral Benefits of sabudana By Dr Bimal chhajer ji #sabudana#healthy #food #recipe#cooking #viral
    February 19, 2026
    Day302: Capsicum Gravy #food #cooking #tamil #recipe #lunch #home #kitchen #school #breakfast #day Day302: Capsicum Gravy #food #cooking #tamil #recipe #lunch #home #kitchen #school #breakfast #day
    February 19, 2026
    Healthy lunch thali #food #viral #recipe #lunch #healthy #homemade #shorts #yt#villagefood #trend Healthy lunch thali #food #viral #recipe #lunch #healthy #homemade #shorts #yt#villagefood #trend
    February 19, 2026
    Previous Next
  • Dinner
    Creamy Omelet #shorts #short#shortvideo #food #recipe #cooking#healthy #trending#viral #thetastybite Creamy Omelet #shorts #short#shortvideo #food #recipe #cooking#healthy #trending#viral #thetastybite
    February 20, 2026
    #minivlog 565#morning healthy recipe#kids tiffin and lunch#most dry#healthyfood #shortvideo #viral #minivlog 565#morning healthy recipe#kids tiffin and lunch#most dry#healthyfood #shortvideo #viral
    February 20, 2026
    #Restaurant style tomato soup Tomato Soup #Healthy soup #Easy soup recipe #Viral shorts #Restaurant style tomato soup Tomato Soup #Healthy soup #Easy soup recipe #Viral shorts
    February 19, 2026
    healthy recipe #ytshorts #shorts #youtubeshorts #shortsfeed #shortsvideo#short @sukanyavlogs708 healthy recipe #ytshorts #shorts #youtubeshorts #shortsfeed #shortsvideo#short @sukanyavlogs708
    February 19, 2026
    Grilled chicken | dinner | air fryer chicken | healthy dinner | salad #grilledchicken Grilled chicken | dinner | air fryer chicken | healthy dinner | salad #grilledchicken
    February 19, 2026
    Previous Next
  • Snacks
    Juicy Spicy Iftar Special Recipe / Ramadan Special Iftar Snacks Recipe / No Oven Chicken Recipe Juicy Spicy Iftar Special Recipe / Ramadan Special Iftar Snacks Recipe / No Oven Chicken Recipe
    February 20, 2026
    Ever Tried Veg Soya Lollipop Sticks Recipe #cooking #soyalallipop #veglallipop #recipe #shortsfeed Ever Tried Veg Soya Lollipop Sticks Recipe #cooking #soyalallipop #veglallipop #recipe #shortsfeed
    February 20, 2026
    masala grapes/2 Minute Masala Grapes| Chatpata Healthy Snack 2026 newshort video #sortvideo #recipe masala grapes/2 Minute Masala Grapes| Chatpata Healthy Snack 2026 newshort video #sortvideo #recipe
    February 20, 2026
    Healthy Ragi Cupcake Recipe | Eggless & No Maida | Soft & Nutritious Finger Millet Cupcakes Healthy Ragi Cupcake Recipe | Eggless & No Maida | Soft & Nutritious Finger Millet Cupcakes
    February 19, 2026
    Moong Daal Chaat | Healthy & Tasty Snack Recipe #shorts Moong Daal Chaat | Healthy & Tasty Snack Recipe #shorts
    February 19, 2026
    Previous Next
  • Weight Loss
    2 Kollu Recipes (For Weight Loss) - Kollu Rasam & Podi || Healthy Recipes || The Traditional Life 2 Kollu Recipes (For Weight Loss) – Kollu Rasam & Podi || Healthy Recipes || The Traditional Life
    February 20, 2026
    weight loss  breakfast  #veggurukitchen  #veggururecepie  #potrecepie  #healthy  #weightlossthai weight loss breakfast #veggurukitchen #veggururecepie #potrecepie #healthy #weightlossthai
    February 20, 2026
    Healthy Suji Veg Chilla Recipe | 10 Min Breakfast | Weight Loss Friendly| #viral#vegchilla#trending Healthy Suji Veg Chilla Recipe | 10 Min Breakfast | Weight Loss Friendly| #viral#vegchilla#trending
    February 19, 2026
    High Protein Paneer Salad | Easy Lunch Recipe | Weight Loss Recipes High Protein Paneer Salad | Easy Lunch Recipe | Weight Loss Recipes
    February 19, 2026
    Odia Saga Muga Dal Recipe | Protein Rich Green Moong Dal with Leafy Greens Odia Saga Muga Dal Recipe | Protein Rich Green Moong Dal with Leafy Greens
    February 19, 2026
    Previous Next
  • Low Calorie
    Lose Weight Fast with These 5 Quick & Healthy Breakfast Ideas!#healthyeating #healthylifestyle Lose Weight Fast with These 5 Quick & Healthy Breakfast Ideas!#healthyeating #healthylifestyle
    February 20, 2026
    KFC Zinger Smash Tacos High Protein Low Calorie Recipe #shorts KFC Zinger Smash Tacos High Protein Low Calorie Recipe #shorts
    February 19, 2026
    High-Protein Snacks Under 5 Minutes #shorts #healthy #quick High-Protein Snacks Under 5 Minutes #shorts #healthy #quick
    February 19, 2026
    High Protein Burger Recipe | Homemade Protein Buns + Low Calorie Sauce High Protein Burger Recipe | Homemade Protein Buns + Low Calorie Sauce
    February 19, 2026
    Protein Rich Chia Seeds And Mix Veg Raita Recipe | Healthy   Easy Veg Curd Recipe | Pink Raita#food Protein Rich Chia Seeds And Mix Veg Raita Recipe | Healthy Easy Veg Curd Recipe | Pink Raita#food
    February 19, 2026
    Previous Next
  • Salad
    Ramadan Special Healthy Salad Recipe #shorts #short #shortvideo #viral Ramadan Special Healthy Salad Recipe #shorts #short #shortvideo #viral
    February 20, 2026
    FREE weekly nutrition plan: lunch recipe #nutrition #recipe #nutritiontips #shorts #healthy #food FREE weekly nutrition plan: lunch recipe #nutrition #recipe #nutritiontips #shorts #healthy #food
    February 19, 2026
    Healthy Rajma Salad Recipe | High Protein Diet Salad | 7 Days 7 Salad Recipes Day 6 Healthy Rajma Salad Recipe | High Protein Diet Salad | 7 Days 7 Salad Recipes Day 6
    February 19, 2026
    Salad khane ke fayde benefits.salad me kya kya khana chahiyeQFruit salad khane ke fayde#salad Salad khane ke fayde benefits.salad me kya kya khana chahiyeQFruit salad khane ke fayde#salad
    February 19, 2026
    Healthy Quinoa Salad Recipe | Indian Style High Protein Lunch/ Dinner | Easy & Refreshing #health Healthy Quinoa Salad Recipe | Indian Style High Protein Lunch/ Dinner | Easy & Refreshing #health
    February 19, 2026
    Previous Next
  • Bread
    Low Carb Kebabs and Homemade Avocado Flatbread | Perfect Air Fryer Meal! Low Carb Kebabs and Homemade Avocado Flatbread | Perfect Air Fryer Meal!
    February 19, 2026
    Suji Ka nashta | Breakfast Recipe | DhoklaRecipe #shorts #youtubeshorts #shortvideo #ytshorts Suji Ka nashta | Breakfast Recipe | DhoklaRecipe #shorts #youtubeshorts #shortvideo #ytshorts
    February 19, 2026
    Make Shawarma Bread and Healthy Cream with Us | Our Homemade Shawarma Recipe Make Shawarma Bread and Healthy Cream with Us | Our Homemade Shawarma Recipe
    February 19, 2026
    Himachali Siddu Recipe | Traditional Steamed Stuffed Bread | #ytshorts #podcast #recipe #cooking Himachali Siddu Recipe | Traditional Steamed Stuffed Bread | #ytshorts #podcast #recipe #cooking
    February 19, 2026
    No bread sandwich| no maida| hari moong dal sandwich| high protein breakfast| ready in 5 mints| food No bread sandwich| no maida| hari moong dal sandwich| high protein breakfast| ready in 5 mints| food
    February 19, 2026
    Previous Next
  • Sandwich
    5 Mint Sandwich Recipe | Quick And Easy  Sandwich | Healthy And Testy Sandwich Recipe 5 Mint Sandwich Recipe | Quick And Easy Sandwich | Healthy And Testy Sandwich Recipe
    February 20, 2026
    #Healthy and tasty recipe#Avocado sandwich#cookingvideo # #Healthy and tasty recipe#Avocado sandwich#cookingvideo #
    February 20, 2026
    Without Fire Simple Sandwich Recipe | Instant Healthy Veg Sandwich #shorts #viral Without Fire Simple Sandwich Recipe | Instant Healthy Veg Sandwich #shorts #viral
    February 19, 2026
    Chicken cheese bread pocket//Bread sandwich recipe//chicken cheese sandwich! Chicken cheese bread pocket//Bread sandwich recipe//chicken cheese sandwich!
    February 19, 2026
    Family breakfast at the cottage | easy sandwiches & smoothie Family breakfast at the cottage | easy sandwiches & smoothie
    February 19, 2026
    Previous Next
3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱
Breakfast

3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱

By UCOOK March 6, 2020

Here are 3 easy and healthy vegan breakfast ideas! I hope this can be helpful to you if your stuck on what to make for breakfast!

CHECK OUT MY LAST VIDEO-

Thank you so much for watching and please let me know what you would like to see next!

Please press that LIKE button if you want me to make more videos like this and SUBSCRIBE because you wont want to miss my next video silly billy!!

Lets grow vegan together !

#Healthybreakfastideas3easyhealthybreakfastideas3easyhealthyveganbreakfastideasampBreakfastbreakfast ideasCuisinedairyfreebreakfasteasyeasyhealthybreakfasteasyhealthybreakfastideaseasyveganbreakfasteasyveganmealemmachaimberlainfunnyveganhealthyhealthy breakfastHealthy Breakfast IdeasHealthy Breakfast RecipesHealthy CuisineHealthy Ideashealthy recipeshealthyveganbreakfasthealthyveganmealhowtobeveganhowtoeatveganideasnataliewislerplantbasedbreakfastquickveganbreakfastquickveganmealquickveganrecipiesrecipesimpleveganbreakfastsupremebananatransitioningveganveganveganbananarecipieveganbreakfastveganbreakfastsmoothieveganovernightoastVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.