UCOOK: Healthy Ideas
  • Recipes
    Strawberry Protein Ice Cream 37g Protein #protein #healthy #food #icecreamrecipe Strawberry Protein Ice Cream 37g Protein #protein #healthy #food #icecreamrecipe
    March 5, 2026
    I Tested This Viral Healthy Dessert Recipe #healthydessert #highprotein  #healthyrecipes #recipes I Tested This Viral Healthy Dessert Recipe #healthydessert #highprotein #healthyrecipes #recipes
    March 5, 2026
    Lettuce Omlette l Healthy Breakfast l #recipe #lettuce #healthyrecipes Lettuce Omlette l Healthy Breakfast l #recipe #lettuce #healthyrecipes
    March 5, 2026
    Cottage Cheese Beef Rotini | 56g PROTEIN! #highprotein #healthyrecipes #dinner #whatieatinaday Cottage Cheese Beef Rotini | 56g PROTEIN! #highprotein #healthyrecipes #dinner #whatieatinaday
    March 5, 2026
    Healthy beetroot cutlet for toddlers & babies(healthy recipes for kids)beetroot recipes for kids Healthy beetroot cutlet for toddlers & babies(healthy recipes for kids)beetroot recipes for kids
    March 5, 2026
    Previous Next
  • Breakfast
    High Protein Easy Breakfast Recipes | Tiffin Recipes | Healthy Breakfast Ideas | Lunch Box | Chilla High Protein Easy Breakfast Recipes | Tiffin Recipes | Healthy Breakfast Ideas | Lunch Box | Chilla
    March 6, 2026
    Healthy Breakfast Recipe | Murmura masala Poha #healthyfood #sancks #viralrecipe #shorts #poharecipe Healthy Breakfast Recipe | Murmura masala Poha #healthyfood #sancks #viralrecipe #shorts #poharecipe
    March 6, 2026
    Moong dal Chilla| Healthy Breakfast recipe| Lunchbox| Breakfast #trending #shorts #moongdal #chilla Moong dal Chilla| Healthy Breakfast recipe| Lunchbox| Breakfast #trending #shorts #moongdal #chilla
    March 6, 2026
    healthy breakfast and lunch recipes #vizagvlogs #food #cooking healthy breakfast and lunch recipes #vizagvlogs #food #cooking
    March 6, 2026
    Day-6 of 30 Days Healthy Breakfast Recipes for Babies and toddlers | breakfast ideas for babies Day-6 of 30 Days Healthy Breakfast Recipes for Babies and toddlers | breakfast ideas for babies
    March 6, 2026
    Previous Next
  • Lunch
    No Bread Veg Sandwich | Quick Healthy Lunch Box Idea Protein Rich Sandwich | Breadless Healthy Snack No Bread Veg Sandwich | Quick Healthy Lunch Box Idea Protein Rich Sandwich | Breadless Healthy Snack
    March 6, 2026
    15 minute Lunch Meal Prep: 3 Healthy & Easy Recipes 15 minute Lunch Meal Prep: 3 Healthy & Easy Recipes
    March 5, 2026
    Protein Chicken Breakfast Wrap | Easy Make-Ahead Breakfast (430 kcal, 22g Protein) #proteinwrap Protein Chicken Breakfast Wrap | Easy Make-Ahead Breakfast (430 kcal, 22g Protein) #proteinwrap
    March 5, 2026
    5 minutes Instant Breakfast Recipes For Tiffin | Dinner Recipes Vegetarian 5 minutes Instant Breakfast Recipes For Tiffin | Dinner Recipes Vegetarian
    March 5, 2026
    Broccoli salad recipe #jeyashriskitchen Broccoli salad recipe #jeyashriskitchen
    March 5, 2026
    Previous Next
  • Dinner
    I’m a dietitian & here’s an easy healthy dinner idea #dinnerideas #dinner #easyrecipes I’m a dietitian & here’s an easy healthy dinner idea #dinnerideas #dinner #easyrecipes
    March 6, 2026
    Snickers Protein Bowl High Protein Dessert #shorts Snickers Protein Bowl High Protein Dessert #shorts
    March 5, 2026
    healthy daliya recipe #healthy dinner #ytshorts #youtubeshorts #viralshort #tasty daliya recipe healthy daliya recipe #healthy dinner #ytshorts #youtubeshorts #viralshort #tasty daliya recipe
    March 5, 2026
    Amritsari Fruit Ice Cream | Easy & Healthy Dessert | Amritsar Street special Recipe #viral #shorts Amritsari Fruit Ice Cream | Easy & Healthy Dessert | Amritsar Street special Recipe #viral #shorts
    March 5, 2026
    Agr Allah chahte khel ki chizein banae.. #trending#youtubeshorts#shorts#viral#shortvideo#love#short Agr Allah chahte khel ki chizein banae.. #trending#youtubeshorts#shorts#viral#shortvideo#love#short
    March 5, 2026
    Previous Next
  • Snacks
    Dal-Paneer Pancakes || Snacks Recipe || #shorts #archanaeasycooking Dal-Paneer Pancakes || Snacks Recipe || #shorts #archanaeasycooking
    March 6, 2026
    healthy snacks #viralvideo #viral #shorts #video #viralshorts #trending #cookies #millet healthy snacks #viralvideo #viral #shorts #video #viralshorts #trending #cookies #millet
    March 6, 2026
    Healthy Black Chana Chaat Recipe | Quick Chatpata Chana Chaat | Easy Evening Snack #shorts Healthy Black Chana Chaat Recipe | Quick Chatpata Chana Chaat | Easy Evening Snack #shorts
    March 6, 2026
    Healthy (vegan) Girl Scout Thin Mint Cookies! Healthy (vegan) Girl Scout Thin Mint Cookies!
    March 5, 2026
    Chatpati chaat l #fruit #health #foodie #snacks #recipe #youtubeshorts #shorts #viral Chatpati chaat l #fruit #health #foodie #snacks #recipe #youtubeshorts #shorts #viral
    March 5, 2026
    Previous Next
  • Weight Loss
    How to Lose Weight Without a Strict Diet | Fast Weight Loss Tips | Indian Diet by Richa How to Lose Weight Without a Strict Diet | Fast Weight Loss Tips | Indian Diet by Richa
    March 6, 2026
    15 EASY & Healthy Recipes for Weight Loss | WeightWatchers Points & Calories | Quick Meal Ideas 15 EASY & Healthy Recipes for Weight Loss | WeightWatchers Points & Calories | Quick Meal Ideas
    March 6, 2026
    Losing 100 pounds in 2026 by eating in a calorie deficit Losing 100 pounds in 2026 by eating in a calorie deficit
    March 5, 2026
    Day 15 Ramadan Fatloss Challenge #ramadandietplan #ramadan #ramadanchallenge Day 15 Ramadan Fatloss Challenge #ramadandietplan #ramadan #ramadanchallenge
    March 5, 2026
    Protein Rich Sprouts Chilla | Healthy Indian Breakfast #shorts Protein Rich Sprouts Chilla | Healthy Indian Breakfast #shorts
    March 5, 2026
    Previous Next
  • Low Calorie
    Healthy chicken veggies high protein kabab recipe Healthy chicken veggies high protein kabab recipe
    March 5, 2026
    Healthy Quinoa Roti | High Protein & Nutritious Roti Recipe | @MaaIntiBangaramu Healthy Quinoa Roti | High Protein & Nutritious Roti Recipe | @MaaIntiBangaramu
    March 5, 2026
    High protein chocolate truffles. #shorts #ytshorts #recipevault High protein chocolate truffles. #shorts #ytshorts #recipevault
    March 5, 2026
    Parle G Pudding Recipe | 130 Calories Healthy Dessert | Easy Weight Loss Breakfast #healthydessert Parle G Pudding Recipe | 130 Calories Healthy Dessert | Easy Weight Loss Breakfast #healthydessert
    March 5, 2026
    25g Protein Weight Loss Meal Recipe | Healthy Tandoori Bowl | Quick Easy Dinner for Busy Days 25g Protein Weight Loss Meal Recipe | Healthy Tandoori Bowl | Quick Easy Dinner for Busy Days
    March 5, 2026
    Previous Next
  • Salad
    High Protein Lunch for $2 #highprotein #budgetmeals #lunch High Protein Lunch for $2 #highprotein #budgetmeals #lunch
    March 5, 2026
    Healthy Salad | Veg Salad with Egg #shorts #shortsfeed #youtubeshorts Healthy Salad | Veg Salad with Egg #shorts #shortsfeed #youtubeshorts
    March 5, 2026
    Healthy fruit salad recipe Healthy fruit salad recipe
    March 5, 2026
    High Protein Paneer Chickpea Salad | Easy Healthy Meal in 15 Minutes High Protein Paneer Chickpea Salad | Easy Healthy Meal in 15 Minutes
    March 5, 2026
    Healthy salad recipe || #recipe Healthy salad recipe || #recipe
    March 5, 2026
    Previous Next
  • Bread
    5 Min Healthy Bread Omelet Recipe | Quick Breakfast Ideas Telugu | @indianspicebox1 #food 5 Min Healthy Bread Omelet Recipe | Quick Breakfast Ideas Telugu | @indianspicebox1 #food
    March 6, 2026
    10-Minute Cheesy Egg Pizza | Quick Whole Wheat Bread Omelet Hack 10-Minute Cheesy Egg Pizza | Quick Whole Wheat Bread Omelet Hack
    March 5, 2026
    Healthy Red Lentil Bread | No Flour Easy Recipe #Shorts Healthy Red Lentil Bread | No Flour Easy Recipe #Shorts
    March 5, 2026
    Bread + Dahi = Viral Sandwich! | 5 Min Crispy Recipe #shorts #sandwich #youtubeshorts #viral #food Bread + Dahi = Viral Sandwich! | 5 Min Crispy Recipe #shorts #sandwich #youtubeshorts #viral #food
    March 5, 2026
    4 Easy Healthy Bread Recipes | Simple Homemade Baking 4 Easy Healthy Bread Recipes | Simple Homemade Baking
    March 5, 2026
    Previous Next
  • Sandwich
    Most Healthy Sandwich Recipe | Weight Loss Veg Sandwich Recipe | High Protein Sandwich Most Healthy Sandwich Recipe | Weight Loss Veg Sandwich Recipe | High Protein Sandwich
    March 6, 2026
    Healthy and tasty food Healthy and tasty food
    March 6, 2026
    Healthy Sandwich for fitness freaks l Curd Sandwich l #shorts #youtubeshorts #food #recipe #viral Healthy Sandwich for fitness freaks l Curd Sandwich l #shorts #youtubeshorts #food #recipe #viral
    March 5, 2026
    Healthy Veg Sandwich Recipe | Easy Ramadan Iftar Recipe | Ramadan Recipe Healthy Veg Sandwich Recipe | Easy Ramadan Iftar Recipe | Ramadan Recipe
    March 5, 2026
    This BreakfastRecipe  Is So Easy To Make! | Easy Bread & Egg Breakfast |5 minute breakfast ideas This BreakfastRecipe Is So Easy To Make! | Easy Bread & Egg Breakfast |5 minute breakfast ideas
    March 5, 2026
    Previous Next
FOODFIGHTERS#1 EASY TO COOK HEALTHY BREAKFAST PANCAKES - RECIPES TO KEEP YOU FIGHTING FIT!!
Dinner

FOODFIGHTERS#1 EASY TO COOK HEALTHY BREAKFAST PANCAKES – RECIPES TO KEEP YOU FIGHTING FIT!!

By UCOOK May 3, 2020

Thanks for Watching #BBTV Please Like and Subscribe if you liked our content and to see more videos.

Follow us on Social Media…

Instagram:
Twitter:
Facebook:
YouTube:
Website:

#boxing #britishboxing

aky karimbbtvBBTV LiveBoxingBreakfastbritish boxersbritish boxingchris maylettcookCuisinedinnerdinner ideaseasyeasy cook pancakeseasy healhty snackseasy pancake recipeFIGHTINGfitFOODFIGHTERS1greek yoghurt recipehealthyHealthy Breakfast IdeasHealthy Cuisinehealthy dinnerhealthy dinner ideasHealthy dinner recipeshealthy easy mealsHealthy Ideashealthy mealshealthy recipeshealthy snackshome made pancakeshoney drizzled pancakeshow to cook pancakesideasinterviewpancakesquick cookingreciperecipesuk boxinguk fightsVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.