UCOOK: Healthy Ideas
  • Recipes
    Healthy veg vegetable fry rice recipe #shorts #youtubeshorts #recipe #vegtables #fryrice #viralshort Healthy veg vegetable fry rice recipe #shorts #youtubeshorts #recipe #vegtables #fryrice #viralshort
    March 1, 2026
    Garlic Parm Chicken Pasta High Protein Meal Prep Recipe #shorts Garlic Parm Chicken Pasta High Protein Meal Prep Recipe #shorts
    March 1, 2026
    Check bio for protein recipe ebook #caloriedeficit #highprotein #lowcarb #healthyrecipes #EasyRecipe Check bio for protein recipe ebook #caloriedeficit #highprotein #lowcarb #healthyrecipes #EasyRecipe
    March 1, 2026
    Dr.Manish Acharya Ji's healthy Pudina Amla Green Chutney Recipe #shorts#acharyamanishji Dr.Manish Acharya Ji’s healthy Pudina Amla Green Chutney Recipe #shorts#acharyamanishji
    March 1, 2026
    Meal prep ideas, weight loss diet tips, healthy recipes, high protein meals, what I eat in a day Meal prep ideas, weight loss diet tips, healthy recipes, high protein meals, what I eat in a day
    March 1, 2026
    Previous Next
  • Breakfast
    Hare Matar Aur Suji ka Nashta | Healthy & Tasty Breakfast Recipe #shorts#cooking #Shraddha Ki Rasoi Hare Matar Aur Suji ka Nashta | Healthy & Tasty Breakfast Recipe #shorts#cooking #Shraddha Ki Rasoi
    March 1, 2026
    Easy and healthy breakfast recipe #trendingshorts #shortvideo #recipes Easy and healthy breakfast recipe #trendingshorts #shortvideo #recipes
    March 1, 2026
    Hare Matar Se Banaye Tasty And Healthy Breakfast Recipe #matarbreakfast #shorts #shortsfeed #mamta Hare Matar Se Banaye Tasty And Healthy Breakfast Recipe #matarbreakfast #shorts #shortsfeed #mamta
    March 1, 2026
    Instant Healthy Breakfast recipe In just 10 Minutes/ Quick healthy breakfast/ weight loss Breakfast Instant Healthy Breakfast recipe In just 10 Minutes/ Quick healthy breakfast/ weight loss Breakfast
    March 1, 2026
    Easy healthy Breakfast recipe | Puttu |#shorts #viralshorts #viral #youtubeshorts #everydaywithaish Easy healthy Breakfast recipe | Puttu |#shorts #viralshorts #viral #youtubeshorts #everydaywithaish
    March 1, 2026
    Previous Next
  • Lunch
    Egg & Oatmeal Porridge: Quick & Healthy Breakfast Idea for Busy Mornings Egg & Oatmeal Porridge: Quick & Healthy Breakfast Idea for Busy Mornings
    March 2, 2026
    Crockpot Shredded Chicken TACOS | Healthy Budget Meal Crockpot Shredded Chicken TACOS | Healthy Budget Meal
    March 1, 2026
    “Bacho ke Tiffin ka Super Quick & Healthy Nashta | School Lunch Ideas 2026” “Bacho ke Tiffin ka Super Quick & Healthy Nashta | School Lunch Ideas 2026”
    March 1, 2026
    Lets make my Healthy tasty Rajma Aloo Burger#viral#trending#food#shorts#burger#rajma#aloo#fyp#yt Lets make my Healthy tasty Rajma Aloo Burger#viral#trending#food#shorts#burger#rajma#aloo#fyp#yt
    March 1, 2026
    sunday vibes |church|hotel #food #cooking #healthy #lunch #hotel #shortvideo #shortsvideo #shorts sunday vibes |church|hotel #food #cooking #healthy #lunch #hotel #shortvideo #shortsvideo #shorts
    March 1, 2026
    Previous Next
  • Dinner
    5 Minutes Healthy Breakfast Recipes | Wheat Flour Dosa | Breakfast & Dinner Recipes | easy recipes 5 Minutes Healthy Breakfast Recipes | Wheat Flour Dosa | Breakfast & Dinner Recipes | easy recipes
    March 2, 2026
    Simple Healthy Dinner! Simple Healthy Dinner!
    March 1, 2026
    kacchi haldi khane ke fayde#recipe#health#food#shorts kacchi haldi khane ke fayde#recipe#health#food#shorts
    March 1, 2026
    Healthy Paya soup by Kareena kapoor #cooking#ytshorts#celebrity#kareenakapoorkhan#recipe#payasoup#yt Healthy Paya soup by Kareena kapoor #cooking#ytshorts#celebrity#kareenakapoorkhan#recipe#payasoup#yt
    March 1, 2026
    Healthy homemade lassi by Subhash Goyal | Dahi wali lassi recipe #shorts #lassidrink #lassi #viral Healthy homemade lassi by Subhash Goyal | Dahi wali lassi recipe #shorts #lassidrink #lassi #viral
    March 1, 2026
    Previous Next
  • Snacks
    Banana Bread | Ragi Flour Bread | Ragi Banana Bread | Healthy Snack Recipe | Kids School Snack Idea. Banana Bread | Ragi Flour Bread | Ragi Banana Bread | Healthy Snack Recipe | Kids School Snack Idea.
    March 1, 2026
    crunchy pakoda recipe#snacks #pkode 1 March 2026 crunchy pakoda recipe#snacks #pkode 1 March 2026
    March 1, 2026
    Fruits transformation into healthy choco snacks #healthysnacks #fruitsstories @KoshKitchen Fruits transformation into healthy choco snacks #healthysnacks #fruitsstories @KoshKitchen
    March 1, 2026
    Viral Aalu Palak Balls #youtubeshorts #palak #aloo #snacksrecipe #snacks #shorts #shortsfeed #viral Viral Aalu Palak Balls #youtubeshorts #palak #aloo #snacksrecipe #snacks #shorts #shortsfeed #viral
    March 1, 2026
    Healthy snacks recipes for babies and toddler #7monthsbaby #baby #babyfood #snacks #healthy #cooking Healthy snacks recipes for babies and toddler #7monthsbaby #baby #babyfood #snacks #healthy #cooking
    March 1, 2026
    Previous Next
  • Weight Loss
    Drink This Green Juice to Support Weight Loss | Healthy Juice Recipe Drink This Green Juice to Support Weight Loss | Healthy Juice Recipe
    March 1, 2026
    Day 11 Ramadan Fatloss Challenge #ramadanweightloss #ramadandietplan #ramadan Day 11 Ramadan Fatloss Challenge #ramadanweightloss #ramadandietplan #ramadan
    March 1, 2026
    #day 8/30 weight lose challenge #viral shorts #trending shorts #day 8/30 weight lose challenge #viral shorts #trending shorts
    March 1, 2026
    Roasted Makhana #shorts #shortsfeed #recipe #odia #makhana #healthy #weightloss #easyrecipe#ytshorts Roasted Makhana #shorts #shortsfeed #recipe #odia #makhana #healthy #weightloss #easyrecipe#ytshorts
    March 1, 2026
    Frothy ICE-CREAM Coffee Recipe #shorts #coffee #spiceupflavourskitchen Frothy ICE-CREAM Coffee Recipe #shorts #coffee #spiceupflavourskitchen
    March 1, 2026
    Previous Next
  • Low Calorie
    4 INGREDIENTS, HIGH PROTEIN, LOW CALORIE & ZERO FAT - Easy, Quick, Creamy, Healthy & Delicious 4 INGREDIENTS, HIGH PROTEIN, LOW CALORIE & ZERO FAT – Easy, Quick, Creamy, Healthy & Delicious
    March 1, 2026
    The Ultimate Low-Calorie, High-Protein Tofu Cooking Method The Ultimate Low-Calorie, High-Protein Tofu Cooking Method
    March 1, 2026
    Quick and Healthy Vegetable Dalia #lifebyspandana #weightlossrecipe #shorts #foryou #viral #telugu Quick and Healthy Vegetable Dalia #lifebyspandana #weightlossrecipe #shorts #foryou #viral #telugu
    March 1, 2026
    Chicken Samosa Recipe | Vegetable Samosa | Ramzan Special Recipes | Chicken Samosa Recipe | Vegetable Samosa | Ramzan Special Recipes |
    March 1, 2026
    300 Calorie High Protein Meal | Low Carb & Keto Friendly #shorts 300 Calorie High Protein Meal | Low Carb & Keto Friendly #shorts
    March 1, 2026
    Previous Next
  • Salad
    Healthy Salad #recipe #food Healthy Salad #recipe #food
    March 1, 2026
    Quick & Easy Beetroot Salad | Diet Friendly Recipe #salad #healthysalad #shorts Quick & Easy Beetroot Salad | Diet Friendly Recipe #salad #healthysalad #shorts
    March 1, 2026
    Healthy salad episode2 #ytshorts #recipe #food #foodshorts #viralshort #easyrecipe #healthylifestyle Healthy salad episode2 #ytshorts #recipe #food #foodshorts #viralshort #easyrecipe #healthylifestyle
    March 1, 2026
    Protein-Packed Egg Salad at Home | Quick & Healthy Recipe | Jayalekshmi Official Protein-Packed Egg Salad at Home | Quick & Healthy Recipe | Jayalekshmi Official
    March 1, 2026
    Healthy Boiled Chana Salad | Protein Rich Kala Chana Salad for Weight Loss#shorts #ytshorts #viral Healthy Boiled Chana Salad | Protein Rich Kala Chana Salad for Weight Loss#shorts #ytshorts #viral
    March 1, 2026
    Previous Next
  • Bread
    Lentil Bread Recipe | No Flour & High Protein! #lentils #highprotein #glutenfree #weightloss #shorts Lentil Bread Recipe | No Flour & High Protein! #lentils #highprotein #glutenfree #weightloss #shorts
    March 1, 2026
    Restaurant Style Wheat Naan at Home - 100% Atta Naan without Maida #shorts #viral #youtubeshorts Restaurant Style Wheat Naan at Home – 100% Atta Naan without Maida #shorts #viral #youtubeshorts
    March 1, 2026
    No Bread Chicken Burger | Healthy High Protein Burger Recipe No Bread Chicken Burger | Healthy High Protein Burger Recipe
    March 1, 2026
    Soft, savory, and high-protein.Healthy cheese bread made simple. Soft, savory, and high-protein.Healthy cheese bread made simple.
    March 1, 2026
    Healthy Bread Omelette Recipe for Breakfast #youtubeshorts Healthy Bread Omelette Recipe for Breakfast #youtubeshorts
    March 1, 2026
    Previous Next
  • Sandwich
    Healthy bread sandwich pizza easy recipe for Ramzan Healthy bread sandwich pizza easy recipe for Ramzan
    March 1, 2026
    Crispy Rava Sandwich | Perfect Tiffin Recipe#realdietseries #ytshorts #ytviral #viralshorts #shorts Crispy Rava Sandwich | Perfect Tiffin Recipe#realdietseries #ytshorts #ytviral #viralshorts #shorts
    March 1, 2026
    Chicken Veg Sandwich | Easy & Healthy Homemade Recipe Chicken Veg Sandwich | Easy & Healthy Homemade Recipe
    March 1, 2026
    High Protein Sandwich Recipe | Easy Healthy Breakfast | Paneer Chees Sandwich High Protein Sandwich Recipe | Easy Healthy Breakfast | Paneer Chees Sandwich
    March 1, 2026
    Roti Sandwich Recipe | 5 Minute Breakfast | Easy & Healthy Snack#subscribe #rotisandwich Roti Sandwich Recipe | 5 Minute Breakfast | Easy & Healthy Snack#subscribe #rotisandwich
    March 1, 2026
    Previous Next
Vegetable Steamed Egg Recipe |  Healthy and Tasty | Mehek Delicious Dishes
Lunch

Vegetable Steamed Egg Recipe | Healthy and Tasty | Mehek Delicious Dishes

By UCOOK June 27, 2020

Short video on how to make vegetable steamed egg recipe.

CuisinedeliciousdishesegghealthyHealthy CuisineHealthy IdeasHealthy Lunchhealthy lunch ideasHealthy Lunch Recipeshealthy recipesideaslunchlunch ideasmehekrecipesteamedtastyvegetableVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.