UCOOK: Healthy Ideas
  • Recipes
    Ide menu buka puasa sehat #defisitkalori #menudietharian #menubukapuasa #shorts Ide menu buka puasa sehat #defisitkalori #menudietharian #menubukapuasa #shorts
    February 27, 2026
    5 Min Healthy Lauki Palak Pasta  No Cream Needed! #shorts  #ytshorts #recipes 5 Min Healthy Lauki Palak Pasta No Cream Needed! #shorts #ytshorts #recipes
    February 26, 2026
    Stuffed Appe Recipe #viral #video #trending #viralshorts #ytshorts #food #cooking #healthy #recipe Stuffed Appe Recipe #viral #video #trending #viralshorts #ytshorts #food #cooking #healthy #recipe
    February 26, 2026
    Millet chocolate chip cookies #healthyrecipes #healthydessert Millet chocolate chip cookies #healthyrecipes #healthydessert
    February 26, 2026
    Lou new recipe |lauki ki sabji #bottle gourd recipe#tasty recipe #healthyrecipes #cooking #trending Lou new recipe |lauki ki sabji #bottle gourd recipe#tasty recipe #healthyrecipes #cooking #trending
    February 26, 2026
    Previous Next
  • Breakfast
    Instant Breakfast Recipes #recipe #shorts #viralrecipe #breakfast Instant Breakfast Recipes #recipe #shorts #viralrecipe #breakfast
    February 27, 2026
    healthy breakfast and lunch recipes #food #cooking #vizagvlogs healthy breakfast and lunch recipes #food #cooking #vizagvlogs
    February 27, 2026
    5 mins healthy breakfast #recipe #homecuisine #food #homemadereceipe #viralshort 5 mins healthy breakfast #recipe #homecuisine #food #homemadereceipe #viralshort
    February 27, 2026
    chana masala recipe || healthy breakfast recipes || testy recipe || waight loss recipe || rasoitales chana masala recipe || healthy breakfast recipes || testy recipe || waight loss recipe || rasoitales
    February 26, 2026
    Instant Healthy Breakfasts Oats, Muesli Fruits, Nut & Seeds Recipe #shorts #muesli #viral #recipe Instant Healthy Breakfasts Oats, Muesli Fruits, Nut & Seeds Recipe #shorts #muesli #viral #recipe
    February 26, 2026
    Previous Next
  • Lunch
    #grihalakshmikalpana #food #recipe #cooking #thali #healthy #lunch #viral #ytshorts #grihalakshmikalpana #food #recipe #cooking #thali #healthy #lunch #viral #ytshorts
    February 27, 2026
    lunch box recipe healthy carrot rice lunch box recipe healthy carrot rice
    February 27, 2026
    Millet noodles #youtubeshorts #shorts #healthy #minivlog #vlog #cooking #easyrecipe #food #dailyvlog Millet noodles #youtubeshorts #shorts #healthy #minivlog #vlog #cooking #easyrecipe #food #dailyvlog
    February 27, 2026
    Healthy breakfast and lunch #rajapalayamrecipes Healthy breakfast and lunch #rajapalayamrecipes
    February 27, 2026
    Soyabean ki sukhi sabji.#shortsfeed #cooking #recipe #food #soyabean #sabji #sabjirecipe #healthy Soyabean ki sukhi sabji.#shortsfeed #cooking #recipe #food #soyabean #sabji #sabjirecipe #healthy
    February 27, 2026
    Previous Next
  • Dinner
    Akshay Kumar's Favourite Healthy Starter Recipe#shorts#akshaykumar#trending#healthy#shortsfeed Akshay Kumar’s Favourite Healthy Starter Recipe#shorts#akshaykumar#trending#healthy#shortsfeed
    February 27, 2026
    healthy cheela recipe || rise cheela #shorts #viral #shortsfeed #youtubeshorts healthy cheela recipe || rise cheela #shorts #viral #shortsfeed #youtubeshorts
    February 27, 2026
    Crispy Kovakkai Fry Seiyalama #cooking #shorts #shortsfeed #trending Crispy Kovakkai Fry Seiyalama #cooking #shorts #shortsfeed #trending
    February 27, 2026
    Healthy Digestive fruit good for breakfast/Healthy eating/Diet Recipe #shorts #ytshorts#viral #food Healthy Digestive fruit good for breakfast/Healthy eating/Diet Recipe #shorts #ytshorts#viral #food
    February 27, 2026
    Instant Healthy Breakfast Recipes For Tiffin | New Nasta Recipe Instant Healthy Breakfast Recipes For Tiffin | New Nasta Recipe
    February 27, 2026
    Previous Next
  • Snacks
    Keerai green muruku healthy and tasty #shorts #trending Keerai green muruku healthy and tasty #shorts #trending
    February 27, 2026
    Holi ke gubbare/ Healthy snack recipe for holi party #holiparty #colour #snacks #welcome #shorts Holi ke gubbare/ Healthy snack recipe for holi party #holiparty #colour #snacks #welcome #shorts
    February 27, 2026
    Dahi Phulki(non-fried) for Iftar & Holi #shorts #youtubeshorts #viral #dahiphulki #holi #trending Dahi Phulki(non-fried) for Iftar & Holi #shorts #youtubeshorts #viral #dahiphulki #holi #trending
    February 27, 2026
    Traditional Shenagala Vadalu | Super Crispy & Healthy Snack Recipe | Homemade by Ramaa Raavi Traditional Shenagala Vadalu | Super Crispy & Healthy Snack Recipe | Homemade by Ramaa Raavi
    February 27, 2026
    Healthy snack recipe for weight loss #ahmedabad #weightloss#healthysnacks#gujrati #gujaratisnacks Healthy snack recipe for weight loss #ahmedabad #weightloss#healthysnacks#gujrati #gujaratisnacks
    February 27, 2026
    Previous Next
  • Weight Loss
    Ramadan Weight Loss Drink By Naima Aapa #shorts #trending #viralvideo #recipe #homeremedy #ytshorts Ramadan Weight Loss Drink By Naima Aapa #shorts #trending #viralvideo #recipe #homeremedy #ytshorts
    February 27, 2026
    My Surgical stainless steel Wok Stack cooking Recipes #rjhealthyworld #shots #stackcooking #lunchbox My Surgical stainless steel Wok Stack cooking Recipes #rjhealthyworld #shots #stackcooking #lunchbox
    February 26, 2026
    How to Make Paneer Hyderabadi for Weight Loss | High Protein Fat Loss Recipe | Indian Diet by Richa How to Make Paneer Hyderabadi for Weight Loss | High Protein Fat Loss Recipe | Indian Diet by Richa
    February 26, 2026
    2-Minute High protein Overnight Chia Pudding #youtubeshorts  #Shorts #WeightLoss #healthy #chiaseeds 2-Minute High protein Overnight Chia Pudding #youtubeshorts #Shorts #WeightLoss #healthy #chiaseeds
    February 26, 2026
    Handful Nutrition in Budget for Weight Loss #weightloss #ujjainkiitchen #viral #desighee Handful Nutrition in Budget for Weight Loss #weightloss #ujjainkiitchen #viral #desighee
    February 26, 2026
    Previous Next
  • Low Calorie
    ANTI-INFLAMMATORY Breakfast, Easy and Delicious - No Sugar, Low Calorie, Cheap and Quick ANTI-INFLAMMATORY Breakfast, Easy and Delicious – No Sugar, Low Calorie, Cheap and Quick
    February 26, 2026
    High Protein Veg Tikka Wrap | High Protein Recipes | Vegetarian Recipes #shorts High Protein Veg Tikka Wrap | High Protein Recipes | Vegetarian Recipes #shorts
    February 26, 2026
    5 Low Calorie High Protein Meals Women Over 50 Are Missing 5 Low Calorie High Protein Meals Women Over 50 Are Missing
    February 26, 2026
    RESULT ~ 21 Days weightloss challenge #fitness #weightloss #motivation #diet #food #trending #tamil RESULT ~ 21 Days weightloss challenge #fitness #weightloss #motivation #diet #food #trending #tamil
    February 26, 2026
    Low Fat Paneer at Home | Healthy High-Protein Paneer Recipe | Weight Loss Friendly #paneer Low Fat Paneer at Home | Healthy High-Protein Paneer Recipe | Weight Loss Friendly #paneer
    February 26, 2026
    Previous Next
  • Salad
    Summer Special Viral Cucumber Salad Recipe #shorts #salad#recipe Summer Special Viral Cucumber Salad Recipe #shorts #salad#recipe
    February 27, 2026
    High protein very tasty salad must try #sakad #highproteinbreakfast #food High protein very tasty salad must try #sakad #highproteinbreakfast #food
    February 27, 2026
    HEALTHY SALAD FOR WEIGHT LOSS/CHANA CHAT /IFTAR RECIPE #saladrecipes #weightloss HEALTHY SALAD FOR WEIGHT LOSS/CHANA CHAT /IFTAR RECIPE #saladrecipes #weightloss
    February 27, 2026
    Rajma Salsa Salad Recipe | Healthy Protein Rich Kidney Bean Salad | Weight Loss Salad #ytshorts Rajma Salsa Salad Recipe | Healthy Protein Rich Kidney Bean Salad | Weight Loss Salad #ytshorts
    February 27, 2026
    Chef Pillai’s salad recipe #shorts #healthysalad #chefpillai #iftharrecipes Chef Pillai’s salad recipe #shorts #healthysalad #chefpillai #iftharrecipes
    February 27, 2026
    Previous Next
  • Bread
    Multi Layers Paratha | Laccha Paratha #making #paratha #cooking #shorts Multi Layers Paratha | Laccha Paratha #making #paratha #cooking #shorts
    February 27, 2026
    new recipe #viralvideo #recipe #rashichauhanrecipes #reels #nasta #breakfast recipes #mater bread. new recipe #viralvideo #recipe #rashichauhanrecipes #reels #nasta #breakfast recipes #mater bread.
    February 26, 2026
    Chicken Bread Recipe By Chef M Afzal| Chicken Bread Recipe By Chef M Afzal|
    February 26, 2026
    Egg Bread Fry Easy Breakfast Egg Bread Fry Easy Breakfast
    February 26, 2026
    toh aaj ghar pe banaenge market style Roasted Almond Chocolate #shorts #chocolate #ytshorts toh aaj ghar pe banaenge market style Roasted Almond Chocolate #shorts #chocolate #ytshorts
    February 26, 2026
    Previous Next
  • Sandwich
    Veg Cheese Mayo Sandwich#snacks#shortsfeed #shortvideo#viral#jyoti'skitchencooking Veg Cheese Mayo Sandwich#snacks#shortsfeed #shortvideo#viral#jyoti’skitchencooking
    February 27, 2026
    Healthy Cheese Sandwich Recipe | Ramadan Series Ep 11 | Easy Iftar Snack | Crispy & Cheesy Sandwich Healthy Cheese Sandwich Recipe | Ramadan Series Ep 11 | Easy Iftar Snack | Crispy & Cheesy Sandwich
    February 27, 2026
    Healthy Veg Sandwich in 5 Minutes#Sandwich Recipe#YouTube short Healthy Veg Sandwich in 5 Minutes#Sandwich Recipe#YouTube short
    February 27, 2026
    Healthy Moong Sprout Sandwich: Protein-Packed, Gut-Friendly, and Creative Healthy Moong Sprout Sandwich: Protein-Packed, Gut-Friendly, and Creative
    February 27, 2026
    5 Best Cottage Cheese Snacks for Meal Prep! 5 Best Cottage Cheese Snacks for Meal Prep!
    February 26, 2026
    Previous Next
Healthy & Easy MEAL PREP stress free *weight loss*
Weight Loss

Healthy & Easy MEAL PREP stress free *weight loss*

By UCOOK January 23, 2022

Healthy & Easy MEAL PREP! hey heyyy back with a super easy meal prep vid including macros!

My RECIPE COOKBOOKS:

Subscribe and join the fam!!♡
My Instagram! ♡
@oliviajarviss
Instagram:

used in the video:
kitchen scales –
coconut aminos (soy sauce sub) –
similar containers –

For business inquiries:
hello@oliviajarvis.com

aldimealprepampBudget meal prepcheap food shopcheap meal prep ideasCuisineeasyfatloss mealfreehealthyHealthy Cuisinehealthy easy meal prepHealthy Ideashealthy meal prephealthy recipesHealthy Weight LossHealthy Weight Loss IdeasHealthy weight loss recipeshigh protein meal ideashow to meal prepideasiifymlose belly fatLossmattdoesfitnessMEALmeal prepmeal prep fat lossmeal prep for the weekmeal prep for weight lossmeal prep healthymeal prep ideasmeal prep on budgetolivia jarvis baked oatsone pan meal prepPREPrecipeSTRESStasty meal prepVideoVlogWeightweight lossWeight Loss IdeasWeight loss recipeswhatsinmyfridgewhitneysimmonsYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.