UCOOK: Healthy Ideas
  • Recipes
    The 2-Minute Easy Healthy Smoothie Recipes for Instant Energy! The 2-Minute Easy Healthy Smoothie Recipes for Instant Energy!
    April 4, 2026
    High-protein nutrient-dense chicken pesto pasta #health #nutrition #food #healthyrecipes High-protein nutrient-dense chicken pesto pasta #health #nutrition #food #healthyrecipes
    April 4, 2026
    1 ingredient popsicle recipe! healthy popsicle for kids love #ytshorts #food #viral  #trending 1 ingredient popsicle recipe! healthy popsicle for kids love #ytshorts #food #viral #trending
    April 4, 2026
    Homemade Pomegranate Juice | Anar Juice Recipe | Healthy Drink in Minutes #PomegranateJuice  #anar Homemade Pomegranate Juice | Anar Juice Recipe | Healthy Drink in Minutes #PomegranateJuice #anar
    April 4, 2026
    Ep-1 Healthy Recipe | Healthy Rice Bowl #shorts #healthy Ep-1 Healthy Recipe | Healthy Rice Bowl #shorts #healthy
    April 4, 2026
    Previous Next
  • Breakfast
    healthy breakfast recipe by Acharya Manish #ytstudioes #ytshorts healthy breakfast recipe by Acharya Manish #ytstudioes #ytshorts
    April 4, 2026
    healthy breakfast recipe#full of protein#zero oil recipe#sabut mung chilla  #heathy healthy breakfast recipe#full of protein#zero oil recipe#sabut mung chilla #heathy
    April 4, 2026
    Crispy Pesarattu Recipe | Healthy Breakfast Idea | Instant Moong Dal Dosa Telugu Crispy Pesarattu Recipe | Healthy Breakfast Idea | Instant Moong Dal Dosa Telugu
    April 4, 2026
    No Flour No Maida Only 5 minutes Healthy Breakfast Recipes For Tiffin Quick Dinner Recipe No Flour No Maida Only 5 minutes Healthy Breakfast Recipes For Tiffin Quick Dinner Recipe
    April 4, 2026
    Healthy Breakfast  Recipe// #viral #food #recipe #trending #cooking #easyrecipe #breakfastrecipe Healthy Breakfast Recipe// #viral #food #recipe #trending #cooking #easyrecipe #breakfastrecipe
    April 4, 2026
    Previous Next
  • Lunch
    Healthy Breakfast Fruits Recipes By Acharya Manish Ji's #shortvideo #fruits #food #shorts #breakfast Healthy Breakfast Fruits Recipes By Acharya Manish Ji’s #shortvideo #fruits #food #shorts #breakfast
    April 4, 2026
    Healthy Breakfast Fruits Recipes By Acharya Manish Ji's #shortvideo #fruits #food #shorts Healthy Breakfast Fruits Recipes By Acharya Manish Ji’s #shortvideo #fruits #food #shorts
    April 4, 2026
    Home Made Ghee Pittu super Food and Healthy #shorts #recipe Home Made Ghee Pittu super Food and Healthy #shorts #recipe
    April 4, 2026
    today's lunch thali|Simple lunch thali #shorts#breakfast#food #recipe#cooking#lunch #youtubeshorts today’s lunch thali|Simple lunch thali #shorts#breakfast#food #recipe#cooking#lunch #youtubeshorts
    April 4, 2026
    Healthy Breakfast Fruits Recipes By Acharya Manish Ji's #shortvideo #fruits #food #shorts Healthy Breakfast Fruits Recipes By Acharya Manish Ji’s #shortvideo #fruits #food #shorts
    April 4, 2026
    Previous Next
  • Dinner
    Bitter Gourd Recipe | Karela Sabzi | Healthy Veg Recipe 2026 Bitter Gourd Recipe | Karela Sabzi | Healthy Veg Recipe 2026
    April 4, 2026
    Healthy curd lassi recipe by Dr Subhash Goyal Ji #energy booster lassi #ayurveda Healthy curd lassi recipe by Dr Subhash Goyal Ji #energy booster lassi #ayurveda
    April 4, 2026
    Strong Garlic Taste Gone! Probiotic Fermented Garlic Recipe for Gut Health, Immunity & Healthy Heart Strong Garlic Taste Gone! Probiotic Fermented Garlic Recipe for Gut Health, Immunity & Healthy Heart
    April 4, 2026
    High protein snacks recipe // High protein dosa // Healthy weight loss recipe // High protein snacks recipe // High protein dosa // Healthy weight loss recipe //
    April 4, 2026
    Healthy meal ideas for busy weeknights Healthy meal ideas for busy weeknights
    April 4, 2026
    Previous Next
  • Snacks
    5 Minutes Healthy Snacks Recipes | Egg Snacks | Bread Roll Recipe | New Recipe | Egg Recipe 5 Minutes Healthy Snacks Recipes | Egg Snacks | Bread Roll Recipe | New Recipe | Egg Recipe
    April 4, 2026
    Makhana Namkeen | Healthy & tasty snacks #ootpatang #food #recipe #homemade Makhana Namkeen | Healthy & tasty snacks #ootpatang #food #recipe #homemade
    April 4, 2026
    Ragi Murukku #Ragi (finger millet)  murukku # healthy Snacks Recipe Ragi Murukku #Ragi (finger millet) murukku # healthy Snacks Recipe
    April 4, 2026
    #healthyeveningsnacksrecipe#snacks#mahalaxmitreats#jhalmuri#streetfood#healthysnacks#recipe#foodvlog #healthyeveningsnacksrecipe#snacks#mahalaxmitreats#jhalmuri#streetfood#healthysnacks#recipe#foodvlog
    April 4, 2026
    Healthy Meve ke Laddu with Alsi | No Sugar Healthy Laddu Recipe Healthy Meve ke Laddu with Alsi | No Sugar Healthy Laddu Recipe
    April 4, 2026
    Previous Next
  • Weight Loss
    besan chilla recipe | chilla recipe for weight loss | how to make high protein chilla #highprotein besan chilla recipe | chilla recipe for weight loss | how to make high protein chilla #highprotein
    April 4, 2026
    Jowar Beetroot Roti  | Pink Soft Roti Jowar + Beetroot Healthy Weight Lose Recipe #shortsfeed #food Jowar Beetroot Roti | Pink Soft Roti Jowar + Beetroot Healthy Weight Lose Recipe #shortsfeed #food
    April 4, 2026
    Beetroot lavash | Recipe in description #dietsmartwithtt #weightlossrecipe #lavash Beetroot lavash | Recipe in description #dietsmartwithtt #weightlossrecipe #lavash
    April 4, 2026
    High protein Dinner, breakfast and protein rich snacks recipes //  Healthy weight loss recipe // High protein Dinner, breakfast and protein rich snacks recipes // Healthy weight loss recipe //
    April 4, 2026
    High Protein Salad recipe / Healthy Weight Loss Meal / Protein Salad High Protein Salad recipe / Healthy Weight Loss Meal / Protein Salad
    April 4, 2026
    Previous Next
  • Low Calorie
    Loaded Buffalo Chicken Bowls High Protein Meal Prep Recipe #shorts Loaded Buffalo Chicken Bowls High Protein Meal Prep Recipe #shorts
    April 4, 2026
    Day 3/21 Weightloss Challenge #motivation #weightloss #fitness #food #diet #trending #health  #tamil Day 3/21 Weightloss Challenge #motivation #weightloss #fitness #food #diet #trending #health #tamil
    April 4, 2026
    Nargisi Kofte Recipe | Healthy No Fry Kofta | Low Calorie, High Protein | Better Than Restaurant Nargisi Kofte Recipe | Healthy No Fry Kofta | Low Calorie, High Protein | Better Than Restaurant
    April 4, 2026
    This Healthy Chocolate Cake Will Shock You | No Maida Recipe! #anuradhabhaiya #healthycakerecipe This Healthy Chocolate Cake Will Shock You | No Maida Recipe! #anuradhabhaiya #healthycakerecipe
    April 4, 2026
    Pudding for Weight Loss Journey | Chia Seeds Pudding | Flaxseed Pudding | Sabja Seeds Pudding Pudding for Weight Loss Journey | Chia Seeds Pudding | Flaxseed Pudding | Sabja Seeds Pudding
    April 4, 2026
    Previous Next
  • Salad
    The Best Summer Salad | Keri Kanda Salad #viralvideo #recipe #cooking #shortsfeed #shorts The Best Summer Salad | Keri Kanda Salad #viralvideo #recipe #cooking #shortsfeed #shorts
    April 4, 2026
    Healthy salad Recipe #recipe #food #easyrecipe #cooking #cooking #tasty #recipe #food #ytshorts # Healthy salad Recipe #recipe #food #easyrecipe #cooking #cooking #tasty #recipe #food #ytshorts #
    April 4, 2026
    Viral Cucumber Salad #shorts #recipe #cucumber #salad #cucumbersalad #healthy #diet #viral Viral Cucumber Salad #shorts #recipe #cucumber #salad #cucumbersalad #healthy #diet #viral
    April 4, 2026
    Virat Kohli Favourite Healthy food recipe|Virat Kohli Healthy and Salad recipe#shorts #ytshorts#food Virat Kohli Favourite Healthy food recipe|Virat Kohli Healthy and Salad recipe#shorts #ytshorts#food
    April 3, 2026
    Cucumber Salad | Refreshing Healthy Salad | Kitchen Mastani #healthy #viralvideo Cucumber Salad | Refreshing Healthy Salad | Kitchen Mastani #healthy #viralvideo
    April 3, 2026
    Previous Next
  • Bread
    Super Tasty & Healthy Recipe #shorts #youtubeshorts #viralshorts #trending Super Tasty & Healthy Recipe #shorts #youtubeshorts #viralshorts #trending
    April 4, 2026
    Weekly meal prep Weekly meal prep
    April 4, 2026
    Fresh Homemade Hummus | Mediterranean Dip with Warm Bread Fresh Homemade Hummus | Mediterranean Dip with Warm Bread
    April 3, 2026
    Simple Healthy Recipes for Busy Weekdays | Easy Way to Make a DELICIOUS Breakfast with Bread #recipe Simple Healthy Recipes for Busy Weekdays | Easy Way to Make a DELICIOUS Breakfast with Bread #recipe
    April 3, 2026
    Roti fulane ka sehi tarika #ytshorts #viral #roti#tips #health #shorts #priyarlifestyle #information Roti fulane ka sehi tarika #ytshorts #viral #roti#tips #health #shorts #priyarlifestyle #information
    April 3, 2026
    Previous Next
  • Sandwich
    Veg Sandwich Recipe /Street style veg sandwich recipe/healthy sandwich recipe at home Veg Sandwich Recipe /Street style veg sandwich recipe/healthy sandwich recipe at home
    April 4, 2026
    Quick & Healthy: Edamame Pesto Toast: High Protein Plant-Based Recipe! Quick & Healthy: Edamame Pesto Toast: High Protein Plant-Based Recipe!
    April 4, 2026
    Dahi tadka sandwich recipe #shorts #healthyrecipe Dahi tadka sandwich recipe #shorts #healthyrecipe
    April 4, 2026
    No Bread Sandwich | Super Healthy & Juicy Sandwich Recipe | #shorts #sandwich No Bread Sandwich | Super Healthy & Juicy Sandwich Recipe | #shorts #sandwich
    April 4, 2026
    No Maida No Flour High Protein Healthy Breakfast | Creamy Veg Crepe Recipe |  Tiffin Recipes No Maida No Flour High Protein Healthy Breakfast | Creamy Veg Crepe Recipe | Tiffin Recipes
    April 4, 2026
    Previous Next
Porikadalai Sweet | Snacks Recipes in Tamil | Kids Snacks recipe | Healthy Snack |Samaiyalthiruvizha
Snacks

Porikadalai Sweet | Snacks Recipes in Tamil | Kids Snacks recipe | Healthy Snack |Samaiyalthiruvizha

By UCOOK April 28, 2023

Greetings to Friends and Families of SAMAIYAL THIRUVIZHA,

Hope you Like this video.Kindly Hit on Like share and Subscribe.
Thank You.
SHOW YOUR SUPPORT BY SUBSCRIBING TO MY CHANNEL:

INSTAGRAM :
#shorts
#snacks
#kidssnacksrecipe
#healthysnacks

3ingredientssnacksrecipesintamil5minutessnacksrecipeschickpearecipescountrysugarrecipesCuisinedeevalisweetrecipeseasysnackrecipeintamilfriedpeanutsnackshealthyHealthy CuisineHealthy Ideashealthy recipeshealthy snacksHealthy Snacks IdeasHealthy Snacks RecipeshealthysnacksrecipesintamilhomemadesnacksrecipeshomemadesweetshowtomakesweetrecipesideasKidskidsfavouritesnacksintamilkidssnacksrecipelunchboxrecipesintamilporikadalaiporikadalaiurundaiseivathueppadiporiurundaireciperecipessamaiyalthiruvizhashortssimplesnacksrecipesSnacksnacksSnacks IdeassnacksintamilsummerspecialsweetrecipessweetsweetreceipesintamilsweetrecipesintamilTamilVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.