UCOOK: Healthy Ideas
  • Recipes
    Healthy Juice #healthyjuice #human #bodyparts#beetrootbenefits #shorts #ytshorts Healthy Juice #healthyjuice #human #bodyparts#beetrootbenefits #shorts #ytshorts
    February 8, 2026
    How to Make Kandattu (Yam Dosa) | Healthy Breakfast Recipe | Ramaa Raavi How to Make Kandattu (Yam Dosa) | Healthy Breakfast Recipe | Ramaa Raavi
    February 8, 2026
    Boost your digestion, manage blood sugar, with this natural remedy #viralvedio #shorts #viralvideos Boost your digestion, manage blood sugar, with this natural remedy #viralvedio #shorts #viralvideos
    February 8, 2026
    #weightloss #smoothie #healthyrecipes  #weightlosstips #weightlosstransformation #shorts #fyp #weightloss #smoothie #healthyrecipes #weightlosstips #weightlosstransformation #shorts #fyp
    February 8, 2026
    Make chickpea blondies with me! #baking #healthyrecipes #healthylifestyle #healthybaking Make chickpea blondies with me! #baking #healthyrecipes #healthylifestyle #healthybaking
    February 7, 2026
    Previous Next
  • Breakfast
    Best Tips For Making Moongfali Chaat Recipe || Healthy Breakfast Recipe #shorts #shortvideo #cooking Best Tips For Making Moongfali Chaat Recipe || Healthy Breakfast Recipe #shorts #shortvideo #cooking
    February 8, 2026
    Healthy Chocolate Pancake recipe | Healthy breakfast ideas | High protein recipes | Pancakes Healthy Chocolate Pancake recipe | Healthy breakfast ideas | High protein recipes | Pancakes
    February 8, 2026
    #216 Healthy breakfast #recipe #karuppukavuni #kanji #shorts #216 Healthy breakfast #recipe #karuppukavuni #kanji #shorts
    February 8, 2026
    2 drops Oil Healthy Breakfast Recipe #shorts 2 drops Oil Healthy Breakfast Recipe #shorts
    February 8, 2026
    healthy breakfast recipe by Acharya Manish ji#healthylifestyle#shorts#shortvideo#short healthy breakfast recipe by Acharya Manish ji#healthylifestyle#shorts#shortvideo#short
    February 8, 2026
    Previous Next
  • Lunch
    Beetroot Bethua Lachha Paratha Recipe | Chukander Winter Special #shorts #viral #trending #paratha Beetroot Bethua Lachha Paratha Recipe | Chukander Winter Special #shorts #viral #trending #paratha
    February 8, 2026
    Tawa bhindi recipe | Bhindi ki sabji recipe | #shortsfeed Tawa bhindi recipe | Bhindi ki sabji recipe | #shortsfeed
    February 8, 2026
    Bread recipe day-6 Veggies sandwich #healthy #food #shorts Bread recipe day-6 Veggies sandwich #healthy #food #shorts
    February 8, 2026
    Benefits of Guava by Dr. Robin Sharma #food #healthyfood #health #fruit #guava #recipe #tips Benefits of Guava by Dr. Robin Sharma #food #healthyfood #health #fruit #guava #recipe #tips
    February 8, 2026
    Healthy Chicken Rice Bowl #shorts #shortsfeed #chicken #healthy #lunch #viral #weightloss #trending Healthy Chicken Rice Bowl #shorts #shortsfeed #chicken #healthy #lunch #viral #weightloss #trending
    February 8, 2026
    Previous Next
  • Dinner
    Matar ki Ghugri #food  #cooking  #recipe  #shortvideo  #ytshort  #youtubeshorts Matar ki Ghugri #food #cooking #recipe #shortvideo #ytshort #youtubeshorts
    February 8, 2026
    15 Minute Healthy Snack | Bache Hue Rice Se Easy & Tasty Recipe#tastyfood #ricerecip #healthy#tasty 15 Minute Healthy Snack | Bache Hue Rice Se Easy & Tasty Recipe#tastyfood #ricerecip #healthy#tasty
    February 8, 2026
    Beetroot Paneer Tikki with Curd Dip | Easiest Healthy Dinner Recipe | CookWithSushma Beetroot Paneer Tikki with Curd Dip | Easiest Healthy Dinner Recipe | CookWithSushma
    February 8, 2026
    Boost your immunity+tasty#ytshorts #amlaachar#shortsvideo#recipe #aromaticfood#healthy#winterspecial Boost your immunity+tasty#ytshorts #amlaachar#shortsvideo#recipe #aromaticfood#healthy#winterspecial
    February 8, 2026
    Turn Leftover Rice Into High Protein Healthy Rice #healthy #food #recipe #viral #shorts #viralvideo Turn Leftover Rice Into High Protein Healthy Rice #healthy #food #recipe #viral #shorts #viralvideo
    February 8, 2026
    Previous Next
  • Snacks
    Fish fry #healthy #snacks #fish #ramadan #food #shortsfeed #yt #trending #foodie #iftar #cooking Fish fry #healthy #snacks #fish #ramadan #food #shortsfeed #yt #trending #foodie #iftar #cooking
    February 8, 2026
    Aaj sirf do chijo se ghar pe healthy snacks banaen #minivlog #shortvideo#recipes #food #newvlog Aaj sirf do chijo se ghar pe healthy snacks banaen #minivlog #shortvideo#recipes #food #newvlog
    February 8, 2026
    Healthy Sprouts Moong Chaat Recipe #youtubeshorts #shortsfeed #sprout Healthy Sprouts Moong Chaat Recipe #youtubeshorts #shortsfeed #sprout
    February 8, 2026
    Healthy Namkeen in Airfryer #shorts #recipe #airfryerrecipes #healthysnacks Healthy Namkeen in Airfryer #shorts #recipe #airfryerrecipes #healthysnacks
    February 8, 2026
    shorts indian healthy snacks #recipe #foodytviralvidio shorts indian healthy snacks #recipe #foodytviralvidio
    February 7, 2026
    Previous Next
  • Weight Loss
    3 HIGH PROTEIN meals I eat every week to lose fat (simple to copy) 3 HIGH PROTEIN meals I eat every week to lose fat (simple to copy)
    February 8, 2026
    Healthy Beetroot Salad Recipe for Weight Loss | High Protein Paneer Chole Salad | Easy Diet Salad Healthy Beetroot Salad Recipe for Weight Loss | High Protein Paneer Chole Salad | Easy Diet Salad
    February 8, 2026
    Weight Loss Summer Juice #shorts #weightlossrecipes #weightloss Weight Loss Summer Juice #shorts #weightlossrecipes #weightloss
    February 8, 2026
    Healthy Iftar Recipes for Weight Loss | Ramadan Special Light & Tasty Snacks Healthy Iftar Recipes for Weight Loss | Ramadan Special Light & Tasty Snacks
    February 8, 2026
    super super healthy breakfast for weight loss in one month #recipe #food #nutritionhack #healthdiet super super healthy breakfast for weight loss in one month #recipe #food #nutritionhack #healthdiet
    February 8, 2026
    Previous Next
  • Low Calorie
    10 mins low calorie Coconut Water Hot Pot Recipe #recipe #easyrecipe #healthyrecipes #busylifestyle 10 mins low calorie Coconut Water Hot Pot Recipe #recipe #easyrecipe #healthyrecipes #busylifestyle
    February 8, 2026
    Paneer Salad bowl | Super healthy & Low calorie | Protenicious diet recepie | Paneer Salad bowl | Super healthy & Low calorie | Protenicious diet recepie |
    February 8, 2026
    Gud Imli ki Chutney Recipe | Ramzan Special Chutney for chaat #iftarspecial #ramadan #imlikichatni Gud Imli ki Chutney Recipe | Ramzan Special Chutney for chaat #iftarspecial #ramadan #imlikichatni
    February 8, 2026
    Kim's Magic Pop Snack Review Tasting 6 Delicious Packs of Healthy Popped Grains #SnackReview Kim’s Magic Pop Snack Review Tasting 6 Delicious Packs of Healthy Popped Grains #SnackReview
    February 7, 2026
    Taste Test: Low-Calorie High-Protein Lemon Chicken Bowl (So Good) Taste Test: Low-Calorie High-Protein Lemon Chicken Bowl (So Good)
    February 7, 2026
    Previous Next
  • Salad
    Homemade Dill Salad Recipe - Healthy and Delicious Homemade Dill Salad Recipe – Healthy and Delicious
    February 8, 2026
    Healthy Wraps | Healthy Salad Recipe | High Protein Veg lettuce Wrap | Weight loss #ytshorts Healthy Wraps | Healthy Salad Recipe | High Protein Veg lettuce Wrap | Weight loss #ytshorts
    February 8, 2026
    Orange Walnut Salad | Fresh, Healthy & Flavorful Salad Recipe Orange Walnut Salad | Fresh, Healthy & Flavorful Salad Recipe
    February 8, 2026
    Russian Salad Recipe By farivlogs | Best Healthy Tasty Salad | Best For All Parties | Russian Salad Recipe By farivlogs | Best Healthy Tasty Salad | Best For All Parties |
    February 8, 2026
    Sprouts salad by acharya Manish Ji, healthy salads recipes #shorts #ytshorts #yt #trending #food Sprouts salad by acharya Manish Ji, healthy salads recipes #shorts #ytshorts #yt #trending #food
    February 8, 2026
    Previous Next
  • Bread
    Avocado toast  #recipe #food #chefrestaurant how to make easy at home Avocado toast #recipe #food #chefrestaurant how to make easy at home
    February 8, 2026
    Healthy Hare Matar Ke Kabab| Matar Kabab Recipe| #matarcutlet #ytshorts #shortsfeed Healthy Hare Matar Ke Kabab| Matar Kabab Recipe| #matarcutlet #ytshorts #shortsfeed
    February 8, 2026
    Pocket Bread: The Fastest Food Quick recipes pita bread #shorts Pocket Bread: The Fastest Food Quick recipes pita bread #shorts
    February 8, 2026
    #shorts, gluten-free, oil-free, no refined sugar, healthy oats banana bread! #shorts, gluten-free, oil-free, no refined sugar, healthy oats banana bread!
    February 8, 2026
    Roti sehat bisa tetap enak #kuliner #bandung Roti sehat bisa tetap enak #kuliner #bandung
    February 8, 2026
    Previous Next
  • Sandwich
    Healthy sandwich recipe #veg sandwich recipe #trending #Viralshort #food #cooking # trending music Healthy sandwich recipe #veg sandwich recipe #trending #Viralshort #food #cooking # trending music
    February 8, 2026
    Ragi Beetroot Paratha | Healthy breakfast recipe #shorts #short Ragi Beetroot Paratha | Healthy breakfast recipe #shorts #short
    February 8, 2026
    Chicken Egg Sandwich Recipe | Boiled Egg Sandwich Recipe | Sandwich Recipe | Ramzan Special Recipe Chicken Egg Sandwich Recipe | Boiled Egg Sandwich Recipe | Sandwich Recipe | Ramzan Special Recipe
    February 8, 2026
    Healthy Protein Sandwich Recipe | Easy & Healthy Iftar Snack | Ramadan Healthy Protein Sandwich Recipe | Easy & Healthy Iftar Snack | Ramadan
    February 8, 2026
    Healthy Chicken Sandwich Recipe | No Oven, High Protein, Super Easy! Healthy Chicken Sandwich Recipe | No Oven, High Protein, Super Easy!
    February 7, 2026
    Previous Next
What I Eat In A Day | Healthy Meals
Lunch

What I Eat In A Day | Healthy Meals

By UCOOK July 10, 2016

Welcome back, babes! 💜 Today I show you what my typical meals and snacks look like throughout the day. My goal is to the live the healthiest lifestyle I can, without going crazy! Xo

INSTAGRAM:
WEBSITE:

Pre-Workout I use: &
Protein I use:
BPI Best Protein Bar:
Camera I use:

Find Sloppy Joe Recipe here:

Music by NCS
Tobu – Good Times

6 pack absbeginners guide to fitnessburn belly fatcheap mealscheat mealsCuisineDayeateat cleanfit chickfit famFit GIrlsfitnessfor womenfreefree personal trainerfree workoutget fitgirls that liftgirls with musclegoal settinggrowhealthyHealthy CuisineHealthy IdeasHealthy Lunchhealthy lunch ideasHealthy Lunch Recipeshealthy mealshealthy recipesideasiifymlifestylelive fitloose body fatloose fatlunchlunch ideasmeal prepmeal prep ideamealsmotivationpersonal trainerproteinrecipesummer bodysummer body quicktonetone uptrack your progressVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.