UCOOK: Healthy Ideas
  • Recipes
    Ramadan Special Recipe 2026 / Air fryer Healthy Snacks  / Chicken Bomb #airfryerrecipes #ramadan2026 Ramadan Special Recipe 2026 / Air fryer Healthy Snacks / Chicken Bomb #airfryerrecipes #ramadan2026
    February 23, 2026
    Pancake recipe || Healthy recipes Episode-02 || Anupama Anandkumar Pancake recipe || Healthy recipes Episode-02 || Anupama Anandkumar
    February 23, 2026
    No Maida No Atta Healthy Momos | Veg Momos #vegmomos #viral #recipe #momos #shorts No Maida No Atta Healthy Momos | Veg Momos #vegmomos #viral #recipe #momos #shorts
    February 23, 2026
    Sanjeev Kapoor High Protein Snacks #shorts #viral #trending #recipe #highprotein #snacks #healthy Sanjeev Kapoor High Protein Snacks #shorts #viral #trending #recipe #highprotein #snacks #healthy
    February 23, 2026
    Ramadan Special Healthy Iftar Drink Recipe I Ramadan Energy Drink I Creamy Drink for Iftar Ramadan Special Healthy Iftar Drink Recipe I Ramadan Energy Drink I Creamy Drink for Iftar
    February 23, 2026
    Previous Next
  • Breakfast
    YouTube shorts #like #subscribe #allaripilla hanvika #easy #healthy #breakfast#recipe #poha #ytshort YouTube shorts #like #subscribe #allaripilla hanvika #easy #healthy #breakfast#recipe #poha #ytshort
    February 23, 2026
    10 Minute Healthy Breakfast & Tiffin Special Recipe | Soft & Healthy Veg Paratha | 10 Minute Healthy Breakfast & Tiffin Special Recipe | Soft & Healthy Veg Paratha |
    February 23, 2026
    Healthy Breakfast Recipe #ytshorts #shorts #recipe #food #viral #viralshorts #kanchan Healthy Breakfast Recipe #ytshorts #shorts #recipe #food #viral #viralshorts #kanchan
    February 23, 2026
    Healthy Breakfast Recipe |Poha Nashta |#shorts#murmuhomecooking #shortvideo#shortsfeed Healthy Breakfast Recipe |Poha Nashta |#shorts#murmuhomecooking #shortvideo#shortsfeed
    February 23, 2026
    No Soda No Eno Healthy Instant Breakfast Recipes | New Nasta Recipe No Soda No Eno Healthy Instant Breakfast Recipes | New Nasta Recipe
    February 23, 2026
    Previous Next
  • Lunch
    Lunch Recipe: Rice n murangakkai n veg kulambu | poriyal n snacks #shortsfeed #lunchideas #lunchbox Lunch Recipe: Rice n murangakkai n veg kulambu | poriyal n snacks #shortsfeed #lunchideas #lunchbox
    February 23, 2026
    Healthy lunch recipe: Murungaikai sambar,  Vendaikai pachadi, Beetroot poriyal,  curd,  Pomegranate Healthy lunch recipe: Murungaikai sambar, Vendaikai pachadi, Beetroot poriyal, curd, Pomegranate
    February 23, 2026
    Effortless Fat Loss Lunch Ideas - Quick & Healthy Effortless Fat Loss Lunch Ideas – Quick & Healthy
    February 23, 2026
    #food #whatsinmyplate #healthylunchideas #cooking #healthylunchrecipes #lunch #foodie #lunchrecipes #food #whatsinmyplate #healthylunchideas #cooking #healthylunchrecipes #lunch #foodie #lunchrecipes
    February 22, 2026
    Paneer pulao recipe ||channa recipe||easy lunch recipes Paneer pulao recipe ||channa recipe||easy lunch recipes
    February 22, 2026
    Previous Next
  • Dinner
    Broccoli Soup recipe/ Dinner recipe #soup #healthydiet #healthydinner #weightloss #broccoli #shorts Broccoli Soup recipe/ Dinner recipe #soup #healthydiet #healthydinner #weightloss #broccoli #shorts
    February 23, 2026
    dal khichdi healthy dinner recipe #recipe #cooking #food #shortvideo dal khichdi healthy dinner recipe #recipe #cooking #food #shortvideo
    February 23, 2026
    chura or Matar recipe #homemade #cooking #matar 23 February 2026 chura or Matar recipe #homemade #cooking #matar 23 February 2026
    February 23, 2026
    Ramadan Special Drink | Healthy Creamy Energy Drink Recipe | Ramzan Special Iftar Recipes Ramadan Special Drink | Healthy Creamy Energy Drink Recipe | Ramzan Special Iftar Recipes
    February 23, 2026
    Mumbai famous poha recipe Kapil Sharma reaction #shortvideo #food #shortsfeed #recipe # poha recipe Mumbai famous poha recipe Kapil Sharma reaction #shortvideo #food #shortsfeed #recipe # poha recipe
    February 23, 2026
    Previous Next
  • Snacks
    No Oil - PeaNut Butter.... #shorts No Oil – PeaNut Butter…. #shorts
    February 23, 2026
    23 February 2026 23 February 2026
    February 23, 2026
    Healthy Tomato Nachos snacks Recipe #trending #youtubeshorts #nacho #chips #snacks Healthy Tomato Nachos snacks Recipe #trending #youtubeshorts #nacho #chips #snacks
    February 23, 2026
    Easy Chana Chaat Recipe | Healthy & Chatpati Snack #ramzan #shorts #viral #trending Easy Chana Chaat Recipe | Healthy & Chatpati Snack #ramzan #shorts #viral #trending
    February 23, 2026
    healthy and tasty evening snacks #recipe #shorts healthy and tasty evening snacks #recipe #shorts
    February 23, 2026
    Previous Next
  • Weight Loss
    usirikay 3recipes for health usirikay 3recipes for health
    February 23, 2026
    Healthy Beetroot Salad Recipe | Weight Loss & Summer Special Salad#beetroot #5minuterecipe #salad Healthy Beetroot Salad Recipe | Weight Loss & Summer Special Salad#beetroot #5minuterecipe #salad
    February 23, 2026
    Weight loss recipe. Healthy Millet Kichadi #milletkichadi #milletrecipes #weightlossrecipes #shorts Weight loss recipe. Healthy Millet Kichadi #milletkichadi #milletrecipes #weightlossrecipes #shorts
    February 23, 2026
    eggs recipe #shorts #short#shortvideo #food #recipe #cooking #healthy #trending #viral #thetastybite eggs recipe #shorts #short#shortvideo #food #recipe #cooking #healthy #trending #viral #thetastybite
    February 23, 2026
    Healthy dinner for weight loss #friedrice #healthydinner Healthy dinner for weight loss #friedrice #healthydinner
    February 23, 2026
    Previous Next
  • Low Calorie
    Zero Oil Dahi Bhalla Recipe | Low Calorie High Protein Snack | Healthy Makhana Chaat #healthysnacks Zero Oil Dahi Bhalla Recipe | Low Calorie High Protein Snack | Healthy Makhana Chaat #healthysnacks
    February 22, 2026
    No Fry Murmura Cutlet | Diet Friendly | Low Calorie Healthy Recipe| Air Fryer Weight Loss Snack No Fry Murmura Cutlet | Diet Friendly | Low Calorie Healthy Recipe| Air Fryer Weight Loss Snack
    February 22, 2026
    Guilt-Free Air Fryer Chicken Broast | Crunchy & Low-Calorie Recipe #shorts #shortsfeed Guilt-Free Air Fryer Chicken Broast | Crunchy & Low-Calorie Recipe #shorts #shortsfeed
    February 22, 2026
    Dinner Delight: Low-Calorie & Tasty Dinners Dinner Delight: Low-Calorie & Tasty Dinners
    February 22, 2026
    Low Calorie Healthy Russian Salad Recipe for Weight Loss |  Best Kids Friendly Vegetarian Salad Low Calorie Healthy Russian Salad Recipe for Weight Loss | Best Kids Friendly Vegetarian Salad
    February 22, 2026
    Previous Next
  • Salad
    Refreshing Watermelon Salad Recipes quick salad, fruit salad, watermelon salad recipe, healthy salad Refreshing Watermelon Salad Recipes quick salad, fruit salad, watermelon salad recipe, healthy salad
    February 23, 2026
    Day 5/7 Healthy Recipes | Beetroot Salad #shorts #ytshorts #weightloss #celebrity #theshubhbites Day 5/7 Healthy Recipes | Beetroot Salad #shorts #ytshorts #weightloss #celebrity #theshubhbites
    February 23, 2026
    Best Weight Loss Salad Recipe| Healthy & Filling Meal /Eat This Salad Daily & Lose Weight Fast Best Weight Loss Salad Recipe| Healthy & Filling Meal /Eat This Salad Daily & Lose Weight Fast
    February 23, 2026
    Healthy Salad in 30 Seconds | Quick No-Cook Diet Recipe#food # shorts#recipe #youtube #healthylife# Healthy Salad in 30 Seconds | Quick No-Cook Diet Recipe#food # shorts#recipe #youtube #healthylife#
    February 22, 2026
    healthy salad recipe #youtubeshorts #viralshorts #saladrecipe healthy salad recipe #youtubeshorts #viralshorts #saladrecipe
    February 22, 2026
    Previous Next
  • Bread
    Ramzan iftar recipe | paneer bread cheese recipe #Ramzan recipe #viral recipe Ramzan iftar recipe | paneer bread cheese recipe #Ramzan recipe #viral recipe
    February 23, 2026
    Viral Healthy Double Egg Recipe #shorts #recipe #food #egg #asmr #telugushorts #trending #reels Viral Healthy Double Egg Recipe #shorts #recipe #food #egg #asmr #telugushorts #trending #reels
    February 23, 2026
    Trending recipe of cheese potato  bread rolls #shorts #recipe #potato  #viral #trending #shortsfeed Trending recipe of cheese potato bread rolls #shorts #recipe #potato #viral #trending #shortsfeed
    February 23, 2026
    Just 2 Ingredients Healthy Rice Roti | Soft & Fluffy Rice Roti Recipe | N'Oven Just 2 Ingredients Healthy Rice Roti | Soft & Fluffy Rice Roti Recipe | N’Oven
    February 23, 2026
    Easy Banana Carrot Bread | Healthy Oatmeal Banana Loaf Recipe #baking #recipes #shorts Easy Banana Carrot Bread | Healthy Oatmeal Banana Loaf Recipe #baking #recipes #shorts
    February 22, 2026
    Previous Next
  • Sandwich
    trending chicken sandwich receipe #shortsfeed #shortvideo #chicken #trending #food #cooking #shorts trending chicken sandwich receipe #shortsfeed #shortvideo #chicken #trending #food #cooking #shorts
    February 23, 2026
    egg pratha recipe for Ramadan sehri in village style|healthy egg pratha for sehri egg pratha recipe for Ramadan sehri in village style|healthy egg pratha for sehri
    February 23, 2026
    The Easiest Sandwich Eva! #iftarrecipe #vegetarian #sandwich #maakakhana #youtubeshorts #viral #easy The Easiest Sandwich Eva! #iftarrecipe #vegetarian #sandwich #maakakhana #youtubeshorts #viral #easy
    February 23, 2026
    Healthy and tasty food Healthy and tasty food
    February 23, 2026
    Chicken Shawarma Sandwich Recipe | Best Ramadan Snacks 2026 Chicken Shawarma Sandwich Recipe | Best Ramadan Snacks 2026
    February 23, 2026
    Previous Next
3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱
Breakfast

3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱

By UCOOK March 6, 2020

Here are 3 easy and healthy vegan breakfast ideas! I hope this can be helpful to you if your stuck on what to make for breakfast!

CHECK OUT MY LAST VIDEO-

Thank you so much for watching and please let me know what you would like to see next!

Please press that LIKE button if you want me to make more videos like this and SUBSCRIBE because you wont want to miss my next video silly billy!!

Lets grow vegan together !

#Healthybreakfastideas3easyhealthybreakfastideas3easyhealthyveganbreakfastideasampBreakfastbreakfast ideasCuisinedairyfreebreakfasteasyeasyhealthybreakfasteasyhealthybreakfastideaseasyveganbreakfasteasyveganmealemmachaimberlainfunnyveganhealthyhealthy breakfastHealthy Breakfast IdeasHealthy Breakfast RecipesHealthy CuisineHealthy Ideashealthy recipeshealthyveganbreakfasthealthyveganmealhowtobeveganhowtoeatveganideasnataliewislerplantbasedbreakfastquickveganbreakfastquickveganmealquickveganrecipiesrecipesimpleveganbreakfastsupremebananatransitioningveganveganveganbananarecipieveganbreakfastveganbreakfastsmoothieveganovernightoastVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.