UCOOK: Healthy Ideas
  • Recipes
    Realistic healthy meals ! How’s your Saturday going so far? #glp1 #glp1journey #glp1meals #healthy Realistic healthy meals ! How’s your Saturday going so far? #glp1 #glp1journey #glp1meals #healthy
    April 25, 2026
    Healthy Sugar Free Kulfi Recipe | No Sugar Ice Cream | Easy Dry Fruit Kulfi #shorts Healthy Sugar Free Kulfi Recipe | No Sugar Ice Cream | Easy Dry Fruit Kulfi #shorts
    April 25, 2026
    High Protin evening snack #viral #recipe #yt #healthyrecipes #food #diet #weightloss #cooking High Protin evening snack #viral #recipe #yt #healthyrecipes #food #diet #weightloss #cooking
    April 25, 2026
    Upma ku Cravings ah #ravaupma #healthyrecipes Upma ku Cravings ah #ravaupma #healthyrecipes
    April 25, 2026
    No Maida No Sugar Cake | Healthy Cake Recipe for Weight Loss & Clean Eating Easy Guilt-Free Dessert No Maida No Sugar Cake | Healthy Cake Recipe for Weight Loss & Clean Eating Easy Guilt-Free Dessert
    April 25, 2026
    Previous Next
  • Breakfast
    These 6 Foods Should Be in Your Breakfast | Healthy Breakfast Ideas These 6 Foods Should Be in Your Breakfast | Healthy Breakfast Ideas
    April 25, 2026
    Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts
    April 25, 2026
    Vermicelli Upma # Healthy Breakfast Recipe #ExplorerApoorvaFoodVlogs. Vermicelli Upma # Healthy Breakfast Recipe #ExplorerApoorvaFoodVlogs.
    April 25, 2026
    Instant Recipe | Healthy Breakfast Idea #healthybreakfast #instantrecipe Instant Recipe | Healthy Breakfast Idea #healthybreakfast #instantrecipe
    April 25, 2026
    No Junk ! Healthy Breakfast Recipes | Kids Lunchbox | Easy Indian Breakfast | Tiffin Recipes No Junk ! Healthy Breakfast Recipes | Kids Lunchbox | Easy Indian Breakfast | Tiffin Recipes
    April 25, 2026
    Previous Next
  • Lunch
    #cookwithniku #trending #mangojamrecipe #jamrecipe #food #healthy #viral #viralshorts #shorts #mango #cookwithniku #trending #mangojamrecipe #jamrecipe #food #healthy #viral #viralshorts #shorts #mango
    April 25, 2026
    Best Breakfast For Diabetics - Barley Porridge!#barley #breakfast #food #recipe #shorts #shortsfeed Best Breakfast For Diabetics – Barley Porridge!#barley #breakfast #food #recipe #shorts #shortsfeed
    April 25, 2026
    Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas #food #husband #healthy Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas #food #husband #healthy
    April 25, 2026
    #mangofishcurry # #lunchideas #healthy lunch for summer #. #mangofishcurry # #lunchideas #healthy lunch for summer #.
    April 25, 2026
    healthy lunch box @kesar-vlog healthy lunch box @kesar-vlog
    April 25, 2026
    Previous Next
  • Dinner
    Chick Fil A Breakfast Casserole Meal Prep #shorts Chick Fil A Breakfast Casserole Meal Prep #shorts
    April 25, 2026
    healthy dinner recipe #treanding #viral #cooking #food #dinner #recipe #anitadevshalibhatt healthy dinner recipe #treanding #viral #cooking #food #dinner #recipe #anitadevshalibhatt
    April 25, 2026
    Gluten Free Healthy Chilla Recipe #myjainrecipe Gluten Free Healthy Chilla Recipe #myjainrecipe
    April 25, 2026
    Singdana vali simla mirchi ki sabji | #shortsfeed Singdana vali simla mirchi ki sabji | #shortsfeed
    April 25, 2026
    Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed
    April 25, 2026
    Previous Next
  • Snacks
    Evening Snacks Recipe | Easy And Quick Recipe #shorts #youtubeshorts #trending #snacks Evening Snacks Recipe | Easy And Quick Recipe #shorts #youtubeshorts #trending #snacks
    April 25, 2026
    Healthy n quick recipe #cornchat #chat #makairecipe #bhel #viral #ytshorts #foodie #cooking#trending Healthy n quick recipe #cornchat #chat #makairecipe #bhel #viral #ytshorts #foodie #cooking#trending
    April 25, 2026
    Unique Mudhi Cutlet by Rosys Kitchen | You’ve Never Tasted Puffed Rice Like This Before! Unique Mudhi Cutlet by Rosys Kitchen | You’ve Never Tasted Puffed Rice Like This Before!
    April 25, 2026
    2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort 2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort
    April 24, 2026
    Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings) Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings)
    April 24, 2026
    Previous Next
  • Weight Loss
    High Protein Paneer Sandwich | Easy Healthy Recipe | Weight Loss Friendly#shorts #paneersandwich High Protein Paneer Sandwich | Easy Healthy Recipe | Weight Loss Friendly#shorts #paneersandwich
    April 25, 2026
    Roasted Chana Chaat Recipe #shorts #shortsfeed #food #chaat #amaarrannabynikunja  #chaatrecipe Roasted Chana Chaat Recipe #shorts #shortsfeed #food #chaat #amaarrannabynikunja #chaatrecipe
    April 25, 2026
    Tasty Soyabean Chunks ka nashta #youtubeshorts #recipe #feed #healthysnacks Tasty Soyabean Chunks ka nashta #youtubeshorts #recipe #feed #healthysnacks
    April 25, 2026
    Easy and healthy weight loss drink | babyskitchen #shorts Easy and healthy weight loss drink | babyskitchen #shorts
    April 25, 2026
    Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe
    April 25, 2026
    Previous Next
  • Low Calorie
    This entire breakfast was only 370 cals and 52g of protein! #lowcalorie #highprotein #mealideas This entire breakfast was only 370 cals and 52g of protein! #lowcalorie #highprotein #mealideas
    April 25, 2026
    Dr Manishaa's Secrets For Naturally Glowing & Shiny Skin! #easyrecipe  #glowingskin Dr Manishaa’s Secrets For Naturally Glowing & Shiny Skin! #easyrecipe #glowingskin
    April 25, 2026
    Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak
    April 25, 2026
    kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe
    April 25, 2026
    Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food
    April 24, 2026
    Previous Next
  • Salad
    Skip heavy meals this summer & make this wholesome & refreshing salad! #salad #viral #food #recipe Skip heavy meals this summer & make this wholesome & refreshing salad! #salad #viral #food #recipe
    April 25, 2026
    Healthy Weight Loss Salad Recipe | Healthy Weight Loss Recipe | Healthy Easy Salad Recipe Healthy Weight Loss Salad Recipe | Healthy Weight Loss Recipe | Healthy Easy Salad Recipe
    April 25, 2026
    Healthy Salad Recipe | Chana Lobia Salad Recipe | Weight Loss Recipe | Healthy Salad Recipe | Chana Lobia Salad Recipe | Weight Loss Recipe |
    April 25, 2026
    Strawberry Banana Salad Recipe | Healthy Salad Recipes | Creamy Fruit Salad | Salad Recipe Strawberry Banana Salad Recipe | Healthy Salad Recipes | Creamy Fruit Salad | Salad Recipe
    April 25, 2026
    Channa Salad recipe | healthy breakfast #chana  #healtyfood #healthybreakfast #breakfast Channa Salad recipe | healthy breakfast #chana #healtyfood #healthybreakfast #breakfast
    April 25, 2026
    Previous Next
  • Bread
    easy tasty healthy mithaai recipe#bread sweets dessert#recipe#health#food easy tasty healthy mithaai recipe#bread sweets dessert#recipe#health#food
    April 25, 2026
    Just Oats & Water! No Sugar, No Yeast! This Healthy Bread Has Gone Viral! Just Oats & Water! No Sugar, No Yeast! This Healthy Bread Has Gone Viral!
    April 25, 2026
    Viral Bread breakfast ! Healthy Breakfast #breakfast #eggbread recipe #easyrecipe#odiarecipe Viral Bread breakfast ! Healthy Breakfast #breakfast #eggbread recipe #easyrecipe#odiarecipe
    April 25, 2026
    coconut mango tadgola cooler, a refreshing summer drink #shorts #coconut #summerdrink coconut mango tadgola cooler, a refreshing summer drink #shorts #coconut #summerdrink
    April 25, 2026
    Healthy Bread Omelette | Quick Breakfast in 10-Mins | High Protein Yummy Weight Loss Breakfast Idea Healthy Bread Omelette | Quick Breakfast in 10-Mins | High Protein Yummy Weight Loss Breakfast Idea
    April 25, 2026
    Previous Next
  • Sandwich
    5 Super detox combo juice #nls #naturallifestyle #healthyfood #curedetox #food #facts 5 Super detox combo juice #nls #naturallifestyle #healthyfood #curedetox #food #facts
    April 25, 2026
    Healthy sandwich for breakfast || deep food recipes #like #recipe #food #healthysandwich #breakfast Healthy sandwich for breakfast || deep food recipes #like #recipe #food #healthysandwich #breakfast
    April 25, 2026
    Healthy 5 Min Easy Brown Bread Paneer  Sandwich Breakfast Recipe #shorts #breakfast #sandwich Healthy 5 Min Easy Brown Bread Paneer Sandwich Breakfast Recipe #shorts #breakfast #sandwich
    April 25, 2026
    celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts
    April 25, 2026
    Homemade Healthy Tandoori Paneer Sandwich Homemade Healthy Tandoori Paneer Sandwich
    April 25, 2026
    Previous Next
3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱
Breakfast

3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱

By UCOOK March 6, 2020

Here are 3 easy and healthy vegan breakfast ideas! I hope this can be helpful to you if your stuck on what to make for breakfast!

CHECK OUT MY LAST VIDEO-

Thank you so much for watching and please let me know what you would like to see next!

Please press that LIKE button if you want me to make more videos like this and SUBSCRIBE because you wont want to miss my next video silly billy!!

Lets grow vegan together !

#Healthybreakfastideas3easyhealthybreakfastideas3easyhealthyveganbreakfastideasampBreakfastbreakfast ideasCuisinedairyfreebreakfasteasyeasyhealthybreakfasteasyhealthybreakfastideaseasyveganbreakfasteasyveganmealemmachaimberlainfunnyveganhealthyhealthy breakfastHealthy Breakfast IdeasHealthy Breakfast RecipesHealthy CuisineHealthy Ideashealthy recipeshealthyveganbreakfasthealthyveganmealhowtobeveganhowtoeatveganideasnataliewislerplantbasedbreakfastquickveganbreakfastquickveganmealquickveganrecipiesrecipesimpleveganbreakfastsupremebananatransitioningveganveganveganbananarecipieveganbreakfastveganbreakfastsmoothieveganovernightoastVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.