UCOOK: Healthy Ideas
  • Recipes
    Healthy Banana Shake | #shorts #youtubeshorts #bananashake #quickrecipe Healthy Banana Shake | #shorts #youtubeshorts #bananashake #quickrecipe
    April 6, 2026
    palak dal #dalrecipe  #healthyrecipes  #palakdalrecipe #food #palakpappu #cooking #yummy #trending palak dal #dalrecipe #healthyrecipes #palakdalrecipe #food #palakpappu #cooking #yummy #trending
    April 6, 2026
    BERRY NICE CREAM #easydessert #icecream #healthyrecipes BERRY NICE CREAM #easydessert #icecream #healthyrecipes
    April 6, 2026
    No Flour Banana Blueberry Muffins | Healthy 5 Ingredient Recipe No Flour Banana Blueberry Muffins | Healthy 5 Ingredient Recipe
    April 6, 2026
    Chatpata healthy bhel #healthyrecipes #shortsfeed Chatpata healthy bhel #healthyrecipes #shortsfeed
    April 6, 2026
    Previous Next
  • Breakfast
    Breakfast Ideas Breakfast Ideas
    April 7, 2026
    Healthy Paneer Sandwich | High Protein Breakfast Idea #food #recipe #sandwich #ytshorts #desi #yt Healthy Paneer Sandwich | High Protein Breakfast Idea #food #recipe #sandwich #ytshorts #desi #yt
    April 6, 2026
    Full Protein Breakfast recipe | delicious & healthy breakfast#breakfastrecipe #shorts #healthyfood Full Protein Breakfast recipe | delicious & healthy breakfast#breakfastrecipe #shorts #healthyfood
    April 6, 2026
    Healthy breakfast recipes Healthy breakfast recipes
    April 6, 2026
    Bread Pudla | Breakfast Recipe #shorts #healthy #pudla Bread Pudla | Breakfast Recipe #shorts #healthy #pudla
    April 6, 2026
    Previous Next
  • Lunch
    A LARGE FAMILY What We Eat in a Week! 21 Meals with Our Family! A LARGE FAMILY What We Eat in a Week! 21 Meals with Our Family!
    April 7, 2026
    Crepas saludables de avena #ideasdecomida #recipe #food #cocinaconsabor #foodie #crepes Crepas saludables de avena #ideasdecomida #recipe #food #cocinaconsabor #foodie #crepes
    April 6, 2026
    Vidya Rajesh Kapoor health skin recipe,#trending #ayurved #food #youtube #recipe #cooking Vidya Rajesh Kapoor health skin recipe,#trending #ayurved #food #youtube #recipe #cooking
    April 6, 2026
    Naan & Mushroom Gravy #recipe #healthy #food #cooking #mushroom Naan & Mushroom Gravy #recipe #healthy #food #cooking #mushroom
    April 6, 2026
    Healthy Lunch Ideas | Plate 1 Healthy Lunch Ideas | Plate 1
    April 6, 2026
    Previous Next
  • Dinner
    High Protein Dinner for Weight Loss! Roasted Chicken & Veggies Recipe.#shorts #usa #tanding High Protein Dinner for Weight Loss! Roasted Chicken & Veggies Recipe.#shorts #usa #tanding
    April 6, 2026
    #Day 36| Ghar ka simple dinner| #Healthy recipes #healthydinner #shorts #100dayschallenge #Day 36| Ghar ka simple dinner| #Healthy recipes #healthydinner #shorts #100dayschallenge
    April 6, 2026
    Jarurat Hai Ek Healthy Breakfast Ki !!#shorts #ytshorts #breakfast #recipe Jarurat Hai Ek Healthy Breakfast Ki !!#shorts #ytshorts #breakfast #recipe
    April 6, 2026
    Coach Nitesh Soni's SECRET Healthy Shikanji Premix Recipe for Gut Health ! #shorts #easyrecipe Coach Nitesh Soni’s SECRET Healthy Shikanji Premix Recipe for Gut Health ! #shorts #easyrecipe
    April 6, 2026
    juice ya coffee #tealovers #healthy #freshjuice #recipe #shortfeedviral #trending #viralvideo #yt juice ya coffee #tealovers #healthy #freshjuice #recipe #shortfeedviral #trending #viralvideo #yt
    April 6, 2026
    Previous Next
  • Snacks
    ACAI AT HOME! No added sugar just FRUIT #refreshyourself #acaibowl #healthy ACAI AT HOME! No added sugar just FRUIT #refreshyourself #acaibowl #healthy
    April 6, 2026
    make a late lunch snack plate with me #snacks #snackplate #snackideas #healthysnacks #easylunchideas make a late lunch snack plate with me #snacks #snackplate #snackideas #healthysnacks #easylunchideas
    April 6, 2026
    Pohe recipe | Maharashtrian style kande pohe | Pohe video recipe #food #pohe Pohe recipe | Maharashtrian style kande pohe | Pohe video recipe #food #pohe
    April 6, 2026
    RIce Fufu in Turkey Osso Bucco, Conservative Food Salad, Coconut Snacks! On The Menu With Ekafam! RIce Fufu in Turkey Osso Bucco, Conservative Food Salad, Coconut Snacks! On The Menu With Ekafam!
    April 6, 2026
    healthy snacks healthy breakfast #shorts #shortsfeed #trending #ytshorts #schooltiffinbox #recipe healthy snacks healthy breakfast #shorts #shortsfeed #trending #ytshorts #schooltiffinbox #recipe
    April 6, 2026
    Previous Next
  • Weight Loss
    Menu makan siang sehat dan enak #defisitkalori #menudietharian #shorts Menu makan siang sehat dan enak #defisitkalori #menudietharian #shorts
    April 7, 2026
    best noodles ever #shorts #fitness #gym #weightloss #healthy #lifestyle #cooking #healthylifestyle best noodles ever #shorts #fitness #gym #weightloss #healthy #lifestyle #cooking #healthylifestyle
    April 6, 2026
    Weight loss Breakfast Recipe #reels #weightloss #shorts #trending #healthybreakefast #pushpajkichen Weight loss Breakfast Recipe #reels #weightloss #shorts #trending #healthybreakefast #pushpajkichen
    April 6, 2026
    A healthy weight loss recipe #whatieatinaday #30dayfast  #intermittentfasting A healthy weight loss recipe #whatieatinaday #30dayfast #intermittentfasting
    April 6, 2026
    Not Losing Weight After Delivery?Try This Weight Loss Recipe #trending #viral #shorts #ipl #ai #food Not Losing Weight After Delivery?Try This Weight Loss Recipe #trending #viral #shorts #ipl #ai #food
    April 6, 2026
    Previous Next
  • Low Calorie
    Lemon Garlic Chicken, Spinach & Rice High Protein Meal Prep Recipe #shorts Lemon Garlic Chicken, Spinach & Rice High Protein Meal Prep Recipe #shorts
    April 6, 2026
    Amazing LOW CALORIE & LOW CARB Dinner, No Flour, Cheap, Quick and Healthy (Keto) Amazing LOW CALORIE & LOW CARB Dinner, No Flour, Cheap, Quick and Healthy (Keto)
    April 6, 2026
    Diet Atta and Roti for Weight Loss | Belly Fat Loss Roti Recipe | Weight Loss Recipe Diet Atta and Roti for Weight Loss | Belly Fat Loss Roti Recipe | Weight Loss Recipe
    April 6, 2026
    Healthy Methi Snack | Low Calorie High Protein Snack | Weight Loss Recipe#recipe #food #shorts #diet Healthy Methi Snack | Low Calorie High Protein Snack | Weight Loss Recipe#recipe #food #shorts #diet
    April 6, 2026
    Low calorie pro biotic dessert buy 1 get 1 free Low calorie pro biotic dessert buy 1 get 1 free
    April 6, 2026
    Previous Next
  • Salad
    Raita #trending #food #cookingwithoutfire Raita #trending #food #cookingwithoutfire
    April 6, 2026
    Red lentils curry and Healthy salad Red lentils curry and Healthy salad
    April 6, 2026
    Chickpea Salad | quick weight loss Salad recipe #shorts #chickpeas #salad #highprotein #shortsfeed Chickpea Salad | quick weight loss Salad recipe #shorts #chickpeas #salad #highprotein #shortsfeed
    April 6, 2026
    Diet plan | Monthly Stackup #highproteinrecipe #proteinrichfoods #recipe Diet plan | Monthly Stackup #highproteinrecipe #proteinrichfoods #recipe
    April 6, 2026
    Protein and Fiber Rich Salad | Chana Salad  Healthy Salad #chanasalad #salad #shorts Protein and Fiber Rich Salad | Chana Salad Healthy Salad #chanasalad #salad #shorts
    April 6, 2026
    Previous Next
  • Bread
    Healthy bread Healthy bread
    April 6, 2026
    Healthy Oatmeal Bread Recipe | No Flour | Easy & Diet Friendly Healthy Oatmeal Bread Recipe | No Flour | Easy & Diet Friendly
    April 6, 2026
    Roti fulane ka sehi tarika #ytshorts #viral #shortsfeed #roti #healthy #information #chapati #tips Roti fulane ka sehi tarika #ytshorts #viral #shortsfeed #roti #healthy #information #chapati #tips
    April 6, 2026
    15 Recipes & Ideas To Cook This April By Jamie Oliver 15 Recipes & Ideas To Cook This April By Jamie Oliver
    April 6, 2026
    Easy Bread Toast Recipe #shorts #bread #recipes Easy Bread Toast Recipe #shorts #bread #recipes
    April 6, 2026
    Previous Next
  • Sandwich
    healthy Sandwich Recipe #bhogprasadi #shorts healthy Sandwich Recipe #bhogprasadi #shorts
    April 6, 2026
    Today lunch box #trending #shortsfeed #shorts #asmr #lunchbox #viralshorts #trend #explore #yt #fyp Today lunch box #trending #shortsfeed #shorts #asmr #lunchbox #viralshorts #trend #explore #yt #fyp
    April 6, 2026
    Stop Eating Bread! Try This High Protein Healthy Breakfast | Lunch Box | Tiffin Recipes | Breakfast Stop Eating Bread! Try This High Protein Healthy Breakfast | Lunch Box | Tiffin Recipes | Breakfast
    April 6, 2026
    sandwich recipe | sandwich banane ka tarika | how to make chicken sandwich @Perveenkpakwan sandwich recipe | sandwich banane ka tarika | how to make chicken sandwich @Perveenkpakwan
    April 6, 2026
    Protein Rich hung curd sandwich. Healthy easy breakfast recipes.  Day 6 #shorts #food #recipe Protein Rich hung curd sandwich. Healthy easy breakfast recipes. Day 6 #shorts #food #recipe
    April 6, 2026
    Previous Next
Porikadalai Sweet | Snacks Recipes in Tamil | Kids Snacks recipe | Healthy Snack |Samaiyalthiruvizha
Snacks

Porikadalai Sweet | Snacks Recipes in Tamil | Kids Snacks recipe | Healthy Snack |Samaiyalthiruvizha

By UCOOK April 28, 2023

Greetings to Friends and Families of SAMAIYAL THIRUVIZHA,

Hope you Like this video.Kindly Hit on Like share and Subscribe.
Thank You.
SHOW YOUR SUPPORT BY SUBSCRIBING TO MY CHANNEL:

INSTAGRAM :
#shorts
#snacks
#kidssnacksrecipe
#healthysnacks

3ingredientssnacksrecipesintamil5minutessnacksrecipeschickpearecipescountrysugarrecipesCuisinedeevalisweetrecipeseasysnackrecipeintamilfriedpeanutsnackshealthyHealthy CuisineHealthy Ideashealthy recipeshealthy snacksHealthy Snacks IdeasHealthy Snacks RecipeshealthysnacksrecipesintamilhomemadesnacksrecipeshomemadesweetshowtomakesweetrecipesideasKidskidsfavouritesnacksintamilkidssnacksrecipelunchboxrecipesintamilporikadalaiporikadalaiurundaiseivathueppadiporiurundaireciperecipessamaiyalthiruvizhashortssimplesnacksrecipesSnacksnacksSnacks IdeassnacksintamilsummerspecialsweetrecipessweetsweetreceipesintamilsweetrecipesintamilTamilVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.