UCOOK: Healthy Ideas
  • Recipes
    Sevai upma recipe #shorts #upma #healthy #viral #trending #shortsfeed #cooking Sevai upma recipe #shorts #upma #healthy #viral #trending #shortsfeed #cooking
    February 10, 2026
    Rudra ka Super healthy recipes || #newmom #familychannel #baby #vlog Rudra ka Super healthy recipes || #newmom #familychannel #baby #vlog
    February 10, 2026
    Antioxidants Rich Amla Tea Healthy Drink#recipe #shorts #shortsfeed #healthy Antioxidants Rich Amla Tea Healthy Drink#recipe #shorts #shortsfeed #healthy
    February 10, 2026
    Bang Bang Chicken Bowls #healthydinner #healthyrecipes #chickenrecipe Bang Bang Chicken Bowls #healthydinner #healthyrecipes #chickenrecipe
    February 10, 2026
    Best Beetroot juice recipe to increase Hemoglobin by Acharya Manish ji #health #beetroot #juice Best Beetroot juice recipe to increase Hemoglobin by Acharya Manish ji #health #beetroot #juice
    February 10, 2026
    Previous Next
  • Breakfast
    Healthy Breakfast Recipes | Tiffin Recipes #shorts #breakfast Healthy Breakfast Recipes | Tiffin Recipes #shorts #breakfast
    February 9, 2026
    #healthybreakfast #recipe #youtubeshorts #healthybreakfast #recipe #youtubeshorts
    February 9, 2026
    Beetroot Sponge Dosa/Perfect for Kid Tiffin/Healthy Breakfast#viral#healthyfood#shortvideo#ytshorts Beetroot Sponge Dosa/Perfect for Kid Tiffin/Healthy Breakfast#viral#healthyfood#shortvideo#ytshorts
    February 9, 2026
    ragi pindi upma|upma|ragi pindi|ragi pindi recipes|ragi recipes|healthy breakfast|breakfast#shorts ragi pindi upma|upma|ragi pindi|ragi pindi recipes|ragi recipes|healthy breakfast|breakfast#shorts
    February 9, 2026
    5 minute Instant Breakfast Recipes Indian | Healthy Breakfast Ideas | Tiffin Recipes | Veg Recipes 5 minute Instant Breakfast Recipes Indian | Healthy Breakfast Ideas | Tiffin Recipes | Veg Recipes
    February 9, 2026
    Previous Next
  • Lunch
    Easy Lunch Box Recipe | How To Make Tasty Hotel Mix Recipe | Healthy lunch Recipe Easy Lunch Box Recipe | How To Make Tasty Hotel Mix Recipe | Healthy lunch Recipe
    February 10, 2026
    Healthy Lunch Thali #indianfood #lunchideas #shorts #viral Healthy Lunch Thali #indianfood #lunchideas #shorts #viral
    February 10, 2026
    Odisha famous #pakhala bhata#healthylunch #shortsvideo Odisha famous #pakhala bhata#healthylunch #shortsvideo
    February 10, 2026
    Instant Healthy Breakfast Recipes #shorts  #viralrecipe #recipe #healthybreakfast Instant Healthy Breakfast Recipes #shorts #viralrecipe #recipe #healthybreakfast
    February 10, 2026
    5 Minutes Recipe | Healthy and Quick Breakfast Recipe lunch dinner recipes indian vegetarian snacks 5 Minutes Recipe | Healthy and Quick Breakfast Recipe lunch dinner recipes indian vegetarian snacks
    February 10, 2026
    Previous Next
  • Dinner
    Healthy diner tandoori chicken #shortsviral #airfryer #delicious Healthy diner tandoori chicken #shortsviral #airfryer #delicious
    February 10, 2026
    Sanjay Mishra's Viral Recipe:Chura Matar #reels #shorts Sanjay Mishra’s Viral Recipe:Chura Matar #reels #shorts
    February 9, 2026
    Very healthy and very tasty chana Chaat ki recipe#nazhometastycooking #trending #viralvideo Very healthy and very tasty chana Chaat ki recipe#nazhometastycooking #trending #viralvideo
    February 9, 2026
    Kheer Poori #breakfast #healthy #food #recipe #shorts  #foodie #kheer #poori #ramadan #subhanallah Kheer Poori #breakfast #healthy #food #recipe #shorts #foodie #kheer #poori #ramadan #subhanallah
    February 9, 2026
    #dinner#healthy##homecooking#comfort#shorts #dinner#healthy##homecooking#comfort#shorts
    February 9, 2026
    Previous Next
  • Snacks
    Jowar Oats Crackers | Oats Crackers | Jowar Namak Pare Recipe | Healthy Snacks Jowar Oats Crackers | Oats Crackers | Jowar Namak Pare Recipe | Healthy Snacks
    February 10, 2026
    Zero Oil Hari Matar Ki Chaat | Healthy Winter Snack |Healthy & Tasty Recipe #ytshorts#recipe#shorts Zero Oil Hari Matar Ki Chaat | Healthy Winter Snack |Healthy & Tasty Recipe #ytshorts#recipe#shorts
    February 9, 2026
    3 Easy Healthy Snacks for Kids | Busy Parents’ Go-To Snacks (Fail-Proof Recipes) 3 Easy Healthy Snacks for Kids | Busy Parents’ Go-To Snacks (Fail-Proof Recipes)
    February 9, 2026
    Makhana recipe for weightloss #shorts #makhanarecipe Makhana recipe for weightloss #shorts #makhanarecipe
    February 9, 2026
    Matar and Aate ki Tikki Recipe | Healthy Snacks Without Maida | Easy & Healthy Indian Snacks Recipes Matar and Aate ki Tikki Recipe | Healthy Snacks Without Maida | Easy & Healthy Indian Snacks Recipes
    February 9, 2026
    Previous Next
  • Weight Loss
    How to Make Delicious Weight Loss Chocolates | No Carbs Fat Loss Challenge | Indian Diet by Richa How to Make Delicious Weight Loss Chocolates | No Carbs Fat Loss Challenge | Indian Diet by Richa
    February 10, 2026
    Weight Loss Recipes in 15 Minutes- Mo more  Regular Dosa. Try this PROTEIN-PACKED - Ragi Moong Dosa Weight Loss Recipes in 15 Minutes- Mo more Regular Dosa. Try this PROTEIN-PACKED – Ragi Moong Dosa
    February 9, 2026
    Crispy Ragi Dosa with Besan | Healthy Weight Loss Breakfast Crispy Ragi Dosa with Besan | Healthy Weight Loss Breakfast
    February 9, 2026
    Lose Weight with This 20-Min Recipe | No-Fry Vegetable Santula | #recipe #shorts #homemade Lose Weight with This 20-Min Recipe | No-Fry Vegetable Santula | #recipe #shorts #homemade
    February 9, 2026
    Soft &Spongy Hari Moong Dhokla|High Protein Healthy Breakfast|Weight Loss Recipe #Shorts#Viral#Veg Soft &Spongy Hari Moong Dhokla|High Protein Healthy Breakfast|Weight Loss Recipe #Shorts#Viral#Veg
    February 9, 2026
    Previous Next
  • Low Calorie
    Ninja Creami Cake Batter High-Protein Ice Cream! Ninja Creami Cake Batter High-Protein Ice Cream!
    February 10, 2026
    Bacon Breakfast Bowls High Protein Meal Prep Recipe #shorts Bacon Breakfast Bowls High Protein Meal Prep Recipe #shorts
    February 9, 2026
    High Protein + Low Carb + Fiber (Checks Every Box for Longevity) High Protein + Low Carb + Fiber (Checks Every Box for Longevity)
    February 9, 2026
    Check out my Tasty Chinese Rice Bowl #viral#trending#ricebowl#chinese#food#shorts#ashortaday#rice... Check out my Tasty Chinese Rice Bowl #viral#trending#ricebowl#chinese#food#shorts#ashortaday#rice…
    February 9, 2026
    5 Minutes High Protein Pizza Bites | Healthy Kids Lunchbox Ideas | Tiffin Recipes | Breakfast Recipe 5 Minutes High Protein Pizza Bites | Healthy Kids Lunchbox Ideas | Tiffin Recipes | Breakfast Recipe
    February 9, 2026
    Previous Next
  • Salad
    High Protein Salad #shorts #shortsfeed #highprotein #weightloss #viral #trending #food #recipe High Protein Salad #shorts #shortsfeed #highprotein #weightloss #viral #trending #food #recipe
    February 10, 2026
    Healthy Habits by Vedant Sir #health #food #sprouts #salad #recipe #chana #science #information Healthy Habits by Vedant Sir #health #food #sprouts #salad #recipe #chana #science #information
    February 10, 2026
    Gut-Healthy Salad Ideas I Actually Eat #gutreset #guthealth #salad #antiinflammatory Gut-Healthy Salad Ideas I Actually Eat #gutreset #guthealth #salad #antiinflammatory
    February 9, 2026
    pahadi style papaya salad #shortvideo #papayasalad #healthy #food #ytshorts #salad pahadi style papaya salad #shortvideo #papayasalad #healthy #food #ytshorts #salad
    February 9, 2026
    Lose weight with taste | EASY Protein Salad recipe | Easy and TASTY Protein Salad | Veg Salad Lose weight with taste | EASY Protein Salad recipe | Easy and TASTY Protein Salad | Veg Salad
    February 9, 2026
    Previous Next
  • Bread
    ##gobhi ke paraathe##very tasty recipe## ##gobhi ke paraathe##very tasty recipe##
    February 10, 2026
    High Protein Moong Dal Sandwich #shortsfeed #breakfastideas  #ytshorts #kidslunchbox #eveningsnacks High Protein Moong Dal Sandwich #shortsfeed #breakfastideas #ytshorts #kidslunchbox #eveningsnacks
    February 9, 2026
    No Oil Simple Easy & Tasty Breakfast Recipe  | New Recipes For School Tiffin | Iftar Special Recipe No Oil Simple Easy & Tasty Breakfast Recipe | New Recipes For School Tiffin | Iftar Special Recipe
    February 9, 2026
    Anda Paratha Recipe | Egg Lacha Paratha | Crispy Egg Paratha Recipe | Healthy Breakfast|Quick & Easy Anda Paratha Recipe | Egg Lacha Paratha | Crispy Egg Paratha Recipe | Healthy Breakfast|Quick & Easy
    February 9, 2026
    I Found the MOST AMAZING Bread Recipe Ever! I Found the MOST AMAZING Bread Recipe Ever!
    February 9, 2026
    Previous Next
  • Sandwich
    Healthy sandwich recipe I healthy breakfast healthy you | #healthysandwichrecipe #sandwich #shorts Healthy sandwich recipe I healthy breakfast healthy you | #healthysandwichrecipe #sandwich #shorts
    February 10, 2026
    Quick tasty breakfast with Libra 2 slice sandwichmaker #libra #libraappliances #sandwich #snacks Quick tasty breakfast with Libra 2 slice sandwichmaker #libra #libraappliances #sandwich #snacks
    February 10, 2026
    Sunny Side Up Eggs #shorts #short #viral #trending #food#shortsfeed #healthy #recipe #thetastybites Sunny Side Up Eggs #shorts #short #viral #trending #food#shortsfeed #healthy #recipe #thetastybites
    February 10, 2026
    quick & healthy breakfast recipe | #shorts #healthy #moongdal #nobreadsandwich quick & healthy breakfast recipe | #shorts #healthy #moongdal #nobreadsandwich
    February 10, 2026
    kuchh healthy and tasty recipe #oshikirasoi kuchh healthy and tasty recipe #oshikirasoi
    February 10, 2026
    Previous Next
What I Eat In A Day | Healthy Meals
Lunch

What I Eat In A Day | Healthy Meals

By UCOOK July 10, 2016

Welcome back, babes! 💜 Today I show you what my typical meals and snacks look like throughout the day. My goal is to the live the healthiest lifestyle I can, without going crazy! Xo

INSTAGRAM:
WEBSITE:

Pre-Workout I use: &
Protein I use:
BPI Best Protein Bar:
Camera I use:

Find Sloppy Joe Recipe here:

Music by NCS
Tobu – Good Times

6 pack absbeginners guide to fitnessburn belly fatcheap mealscheat mealsCuisineDayeateat cleanfit chickfit famFit GIrlsfitnessfor womenfreefree personal trainerfree workoutget fitgirls that liftgirls with musclegoal settinggrowhealthyHealthy CuisineHealthy IdeasHealthy Lunchhealthy lunch ideasHealthy Lunch Recipeshealthy mealshealthy recipesideasiifymlifestylelive fitloose body fatloose fatlunchlunch ideasmeal prepmeal prep ideamealsmotivationpersonal trainerproteinrecipesummer bodysummer body quicktonetone uptrack your progressVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.