UCOOK: Healthy Ideas
  • Recipes
    Viral cheese maggi recipe..with a healthy twist #shorts #cheesemacaroni #healthy #cloudkitchen Viral cheese maggi recipe..with a healthy twist #shorts #cheesemacaroni #healthy #cloudkitchen
    March 9, 2026
    #indi5 Minute Instant  Recipe | Healthy Breakfastanfoodmadeeasy #recipe phoh #indi5 Minute Instant Recipe | Healthy Breakfastanfoodmadeeasy #recipe phoh
    March 9, 2026
    Natural Immunity Boosting Juice #shorts #detoxjuice #healthyrecipes Natural Immunity Boosting Juice #shorts #detoxjuice #healthyrecipes
    March 9, 2026
    Viral Healthy Makhana chaat recipe #viral #shorts #shortsfeed #makhanachaat #healthy Viral Healthy Makhana chaat recipe #viral #shorts #shortsfeed #makhanachaat #healthy
    March 9, 2026
    Thyroid friendly Recipe | Bottle gourd with Coconut Milk | Healthy Recipes | Bottle gourd Recipes Thyroid friendly Recipe | Bottle gourd with Coconut Milk | Healthy Recipes | Bottle gourd Recipes
    March 9, 2026
    Previous Next
  • Breakfast
    Easy way to make Paratha for sehri#trending Easy way to make Paratha for sehri#trending
    March 9, 2026
    Kesar Pista Overnight Oats | High Protein High Fiber Breakfast #shorts #oats Kesar Pista Overnight Oats | High Protein High Fiber Breakfast #shorts #oats
    March 9, 2026
    Easy breakfast ideas #shorts #paratha #breakfast #kitchen #cooking #rdlifestyle Easy breakfast ideas #shorts #paratha #breakfast #kitchen #cooking #rdlifestyle
    March 8, 2026
    healthy breakfast ideas for the week #breakfastideas #healthyeating #wieiadhealthy healthy breakfast ideas for the week #breakfastideas #healthyeating #wieiadhealthy
    March 8, 2026
    Power Protein Overnight Oats | Healthy 5-Minute Breakfast #shorts #viral #trending #ytshorts Power Protein Overnight Oats | Healthy 5-Minute Breakfast #shorts #viral #trending #ytshorts
    March 8, 2026
    Previous Next
  • Lunch
    Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe
    March 9, 2026
    5 Minutes Pasta Recipes | Easy Microne Recipes | Instant pasta Recipe #shorts #viral shorts #food 5 Minutes Pasta Recipes | Easy Microne Recipes | Instant pasta Recipe #shorts #viral shorts #food
    March 9, 2026
    High Protein Ice Cream Sandwiches #protein #diet #food #healthy High Protein Ice Cream Sandwiches #protein #diet #food #healthy
    March 8, 2026
    Healthy lunch recipe | Pinki'sKitchen | #shortsfeed #ytshorts #shorts #recipe Healthy lunch recipe | Pinki’sKitchen | #shortsfeed #ytshorts #shorts #recipe
    March 8, 2026
    Healthy food# healthy lunch#recipe Healthy food# healthy lunch#recipe
    March 8, 2026
    Previous Next
  • Dinner
    spicy masala amrud #food #healthy #recipe spicy masala amrud #food #healthy #recipe
    March 9, 2026
    Chilli Gobi Recipe #viral #viralvideo #video #viralshorts #viralshort #vlog #viralvideos #viralreels Chilli Gobi Recipe #viral #viralvideo #video #viralshorts #viralshort #vlog #viralvideos #viralreels
    March 9, 2026
    Healthy Chana Daal/chana dal chaat #recipe #trending #ytshorts #like #shorts Healthy Chana Daal/chana dal chaat #recipe #trending #ytshorts #like #shorts
    March 9, 2026
    Zero oil Chaat for weightloss #shorts #youtubeshorts #viral #healthy #weightloss #trending #iftar Zero oil Chaat for weightloss #shorts #youtubeshorts #viral #healthy #weightloss #trending #iftar
    March 9, 2026
    Perfect Dal Khichdi Recipe| Healthy & protein-packed dinner Perfect Dal Khichdi Recipe| Healthy & protein-packed dinner
    March 9, 2026
    Previous Next
  • Snacks
    Mint flavour Makhana | weight loss friendly #healthysnacks #weightloss #easytomake #makhana Mint flavour Makhana | weight loss friendly #healthysnacks #weightloss #easytomake #makhana
    March 9, 2026
    Easy healthy snacks recipe #shorts #healthy #appe #moongdal #recipe Easy healthy snacks recipe #shorts #healthy #appe #moongdal #recipe
    March 9, 2026
    Healthy Bun Dosa | Instant Snacks Recipe #food #shorts #cooking #recipe #dosa #curdrice Healthy Bun Dosa | Instant Snacks Recipe #food #shorts #cooking #recipe #dosa #curdrice
    March 9, 2026
    Healthy Moong Dal Nuggets | Crispy Snack Without Deep Fry | High Protein Snack Healthy Moong Dal Nuggets | Crispy Snack Without Deep Fry | High Protein Snack
    March 9, 2026
    Tandoori mayonnaise recipe #quickrecipe #mayonnaise #healthymayonnaise #healthysnacks #food Tandoori mayonnaise recipe #quickrecipe #mayonnaise #healthymayonnaise #healthysnacks #food
    March 8, 2026
    Previous Next
  • Weight Loss
    High Protein Pizza No Maida No Oven Sprouts Pizza for Weight Loss and Kids Friendly #shorts #pizza High Protein Pizza No Maida No Oven Sprouts Pizza for Weight Loss and Kids Friendly #shorts #pizza
    March 9, 2026
    vegetable moonglet //a healthy breakfast //lunch recipe #trending #health #weightloss #shorts vegetable moonglet //a healthy breakfast //lunch recipe #trending #health #weightloss #shorts
    March 8, 2026
    Millet upma , Weightloss friendly, Diabetic friendly. Full recipe is in description by Millet upma , Weightloss friendly, Diabetic friendly. Full recipe is in description by
    March 8, 2026
    Weight Loss Special Daliya Upma | High Fiber Healthy Meal #shorts #food #recipe #cooking #viral Weight Loss Special Daliya Upma | High Fiber Healthy Meal #shorts #food #recipe #cooking #viral
    March 8, 2026
    Healthy Weightloss Sunnah Inspired Recipe #talbina #weightloss #healthyfood #shortsfeed #trending Healthy Weightloss Sunnah Inspired Recipe #talbina #weightloss #healthyfood #shortsfeed #trending
    March 8, 2026
    Previous Next
  • Low Calorie
    Low calorie high protein chicken crust pizza - easy healthy dinner Low calorie high protein chicken crust pizza – easy healthy dinner
    March 8, 2026
    Chinese Takeout Under 600 Calories (Weight Loss Hack) Chinese Takeout Under 600 Calories (Weight Loss Hack)
    March 8, 2026
    Subah Khali Pet Lauki Juice?RamdevBaba Health Secrets | Bottle Gourd JuiceBenefits #shorts #fyp Subah Khali Pet Lauki Juice?RamdevBaba Health Secrets | Bottle Gourd JuiceBenefits #shorts #fyp
    March 8, 2026
    My Favorite Low Calorie Ingredients for Losing Fat (25 Recipes) My Favorite Low Calorie Ingredients for Losing Fat (25 Recipes)
    March 8, 2026
    Healthy Zucchini Cutlets | Low Calorie Snack for Weight Loss Healthy Zucchini Cutlets | Low Calorie Snack for Weight Loss
    March 8, 2026
    Previous Next
  • Salad
    Easy Matki Sprouts Salad |Instant Healthy Salad Recipe#salad #sprout #shorts Easy Matki Sprouts Salad |Instant Healthy Salad Recipe#salad #sprout #shorts
    March 9, 2026
    Mixed vegetable Salad  Recipe #shorts #youtubeshorts #viralshorts #cooking #viral Mixed vegetable Salad Recipe #shorts #youtubeshorts #viralshorts #cooking #viral
    March 9, 2026
    5 Min Detox Recipe/Diabetes Friendly Healthy Salad/ Immunity Boosting Salad Recipe 5 Min Detox Recipe/Diabetes Friendly Healthy Salad/ Immunity Boosting Salad Recipe
    March 9, 2026
    Healthy salad recipe #salad #saladrecipe #healthybreakefast #food #shorts #recipe #viral #cooking Healthy salad recipe #salad #saladrecipe #healthybreakefast #food #shorts #recipe #viral #cooking
    March 9, 2026
    cowboy caviar but make it high protein cowboy caviar but make it high protein
    March 9, 2026
    Previous Next
  • Bread
    Easy And Healthy Breakfast Ideas For Tiffin | Kids Lunchbox Recipes | Tiffin Recipes | Lunch Box Easy And Healthy Breakfast Ideas For Tiffin | Kids Lunchbox Recipes | Tiffin Recipes | Lunch Box
    March 9, 2026
    Easy Healthy Breakfast in 5mins | High Protein Breakfast/Snacks Recipes | Jhatpatkitchenecipes Easy Healthy Breakfast in 5mins | High Protein Breakfast/Snacks Recipes | Jhatpatkitchenecipes
    March 9, 2026
    Bread without flour or eggs! Just take a cup of chickpeas and flax seeds! Lots of protein! Bread without flour or eggs! Just take a cup of chickpeas and flax seeds! Lots of protein!
    March 9, 2026
    10 Minutes Healthy Protein| Cottage Cheese Flatbread #shorts 10 Minutes Healthy Protein| Cottage Cheese Flatbread #shorts
    March 8, 2026
    Healthy Sunday breakfast ideas yammy yammy #shortsfeed #shortvideo #youtube #shorts #trending Healthy Sunday breakfast ideas yammy yammy #shortsfeed #shortvideo #youtube #shorts #trending
    March 8, 2026
    Previous Next
  • Sandwich
    5 minutes easy and healthy sandwich #iftar #shorts 5 minutes easy and healthy sandwich #iftar #shorts
    March 9, 2026
    Paneer Sandwich || Vegetable Sandwich || Healthy Sandwich recipes Paneer Sandwich || Vegetable Sandwich || Healthy Sandwich recipes
    March 9, 2026
    Fatafat Chicken Sandwich Recipe for breakfast or evening snacks. Healthy and tasty recipe Fatafat Chicken Sandwich Recipe for breakfast or evening snacks. Healthy and tasty recipe
    March 9, 2026
    Healthy Sooji Matar Sandwich Recipe | Instant Breakfast Recipe | No Maida Sandwich Healthy Sooji Matar Sandwich Recipe | Instant Breakfast Recipe | No Maida Sandwich
    March 9, 2026
    Panner Cheese Sandwich-High Protein #food #shorts #ytshorts #yummy #sandwich #diet #panner #snacks Panner Cheese Sandwich-High Protein #food #shorts #ytshorts #yummy #sandwich #diet #panner #snacks
    March 8, 2026
    Previous Next
Healthy Salad | Healthy food | Avocado Cucumber Tomato Salad for your life #shorts #youtube
Salad

Healthy Salad | Healthy food | Avocado Cucumber Tomato Salad for your life #shorts #youtube

By UCOOK September 25, 2021

I love this simple Avocado, Cucumber, Tomato Salad as it is fresh, fun, healthy and packed with full of flavor. It’s so quick to make and the ultimate side dish for potlucks, BBQs, picnics, and mid-week meals! Oh Yeah !!!!!

Would you like make this salad? Try it !
It is easy and healthy for your life !

#easyrecipes#TastyFoodavocadoavocado cucumber tomato saladBBQsCucumberCuisinedeliciousDietplandinnertimedish for potluckseasyfoodfitfoodfitnessfoodFITRECIPESfoodfoodbeastfoodiefoodvideoFreshFriendFRIENDSfunhealthyhealthy and packed with flavorHealthy CuisineHealthy Ideashealthy recipeshealthy saladHealthy Salad IdeasHealthy Salad RecipeshealthyfoodhealthylifestylehealthymealprephealthymealsideasInstafoodLifeLovemakemealprepmealpreprecipesmid-week mealspicnicsreciperecipevideosaladSalad Ideassalad recipesshortshortstastytomatoVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.