UCOOK: Healthy Ideas
  • Recipes
    Bihari red saag quick healthy recipes!#recipe #viral Bihari red saag quick healthy recipes!#recipe #viral
    April 27, 2026
    Healthy Moong Dal Pizza | No Maida, High Protein Pizza Recipe | Easy & Tasty Homemade Pizza #shorts Healthy Moong Dal Pizza | No Maida, High Protein Pizza Recipe | Easy & Tasty Homemade Pizza #shorts
    April 27, 2026
    high protein salad #shorts #youtubeshorts #viral #trending #weightloss #recipe #food #healthy #salad high protein salad #shorts #youtubeshorts #viral #trending #weightloss #recipe #food #healthy #salad
    April 27, 2026
    Healthy Methi Recipe with Banana Magic | Must Try Recipe By Chef Sanjeev Kapoor @foodfoodindia Healthy Methi Recipe with Banana Magic | Must Try Recipe By Chef Sanjeev Kapoor @foodfoodindia
    April 27, 2026
    Healthy Cornflakes bowl | High fiber breakfast #shorts #youtubeshorts #viralvideo #food #recipe Healthy Cornflakes bowl | High fiber breakfast #shorts #youtubeshorts #viralvideo #food #recipe
    April 27, 2026
    Previous Next
  • Breakfast
    Quick and Healthy Breakfast Ideas | Kids Lunchbox | Easy Breakfast Recipe | Tiffin Recipes | Nashta Quick and Healthy Breakfast Ideas | Kids Lunchbox | Easy Breakfast Recipe | Tiffin Recipes | Nashta
    April 27, 2026
    Ragi dosa | Healthy breakfast ideas | millet dosa | Annapurna kitchen #shorts #trending #viral #fyp Ragi dosa | Healthy breakfast ideas | millet dosa | Annapurna kitchen #shorts #trending #viral #fyp
    April 27, 2026
    Instant Moong Dal Chilla | Healthy Breakfast in Minutes!#moongdalchillarecipe #chilla #viral #yt Instant Moong Dal Chilla | Healthy Breakfast in Minutes!#moongdalchillarecipe #chilla #viral #yt
    April 27, 2026
    Poha recipe| Healthy breakfast| Kanda Poha #food #poha #shorts #healthyfood #breakfast #pohe Poha recipe| Healthy breakfast| Kanda Poha #food #poha #shorts #healthyfood #breakfast #pohe
    April 27, 2026
    Easy and Healthy Breakfast Ideas | Kids Lunchbox | Breakfast Recipes | Tiffin Recipes | Nashta Easy and Healthy Breakfast Ideas | Kids Lunchbox | Breakfast Recipes | Tiffin Recipes | Nashta
    April 27, 2026
    Previous Next
  • Lunch
    42gms HIGH PROTEIN YOGHURT BOWL FOR YOUR BREAKFAST #breakfastrecipe #healthyrecipes #food #protein 42gms HIGH PROTEIN YOGHURT BOWL FOR YOUR BREAKFAST #breakfastrecipe #healthyrecipes #food #protein
    April 27, 2026
    Aaj ke Lunch me ye banaya tha #shorts #shortsfeed #trendingshorts #viralvideo #bristihomekitchen Aaj ke Lunch me ye banaya tha #shorts #shortsfeed #trendingshorts #viralvideo #bristihomekitchen
    April 27, 2026
    Healthy lunch box recipe / Healthy lunch box recipe /
    April 27, 2026
    No Fat Healthy Lunch Idea!! #lunch #shortsfeed #shortsvideo #ideas #lunchideas No Fat Healthy Lunch Idea!! #lunch #shortsfeed #shortsvideo #ideas #lunchideas
    April 26, 2026
    Simple Healthy Lunch Idea #shorts #youtubeshorts #healthyeating #healthylunch #lunchideas Simple Healthy Lunch Idea #shorts #youtubeshorts #healthyeating #healthylunch #lunchideas
    April 26, 2026
    Previous Next
  • Dinner
    healthy recipe #moongdal #youtubeshorts healthy recipe #moongdal #youtubeshorts
    April 27, 2026
    Zero Oil Cooking By Dr. Bimal Chhajer #shorts Zero Oil Cooking By Dr. Bimal Chhajer #shorts
    April 27, 2026
    Grilled Chicken & Mexican Rice Bowl #dinner #recipe #cooking #food #mealprep #healthy Grilled Chicken & Mexican Rice Bowl #dinner #recipe #cooking #food #mealprep #healthy
    April 27, 2026
    Healthy Oats Biscuit #recipe #healthybiscuits #cookies #recipe #food #healthylifestyle #healthytips Healthy Oats Biscuit #recipe #healthybiscuits #cookies #recipe #food #healthylifestyle #healthytips
    April 27, 2026
    Healthy dinner recipe for kids Jowar balls Healthy dinner recipe for kids Jowar balls
    April 27, 2026
    Previous Next
  • Snacks
    Red Spinach Pakora | Crispy & Healthy Snack #pakora #shorts #recipe #cooking Red Spinach Pakora | Crispy & Healthy Snack #pakora #shorts #recipe #cooking
    April 27, 2026
    #love #motivation #sad #ytshorts #food #snacks #momos #cooking#homecooked #healthy#recipe #ytshorts #love #motivation #sad #ytshorts #food #snacks #momos #cooking#homecooked #healthy#recipe #ytshorts
    April 27, 2026
    Instant Oats Idli #High Fibere Oats Idli #Oats Recipe #healthy breakfast recipe Instant Oats Idli #High Fibere Oats Idli #Oats Recipe #healthy breakfast recipe
    April 27, 2026
    Crispy Air Fryer Jackfruit Recipe | Less Oil Healthy Snack #recipe #cooking #airfryer Crispy Air Fryer Jackfruit Recipe | Less Oil Healthy Snack #recipe #cooking #airfryer
    April 27, 2026
    Tiffin Recipe | Lunchbox |Nashta Recipe| Breakfast| Snacks #shorts #easyrecipe #tiffin #snacks #food Tiffin Recipe | Lunchbox |Nashta Recipe| Breakfast| Snacks #shorts #easyrecipe #tiffin #snacks #food
    April 27, 2026
    Previous Next
  • Weight Loss
    3 benifits of eating apple gourd| tiday khana k Fayde #shorts #tindayrecipe#tenda#tenday #applegourd 3 benifits of eating apple gourd| tiday khana k Fayde #shorts #tindayrecipe#tenda#tenday #applegourd
    April 27, 2026
    Morning healthy breakfast for healthy life#trending #viral #healthybreakfast Morning healthy breakfast for healthy life#trending #viral #healthybreakfast
    April 27, 2026
    No Rice Ragi Uttapam for weight loss #shorts #youtubeshorts #viral #trending #ragi #weightloss #food No Rice Ragi Uttapam for weight loss #shorts #youtubeshorts #viral #trending #ragi #weightloss #food
    April 27, 2026
    Shraddha Kapoor's Favorite Instant Mango Achaar Recipe #shorts #shraddhakapoor #achar #ashortaday Shraddha Kapoor’s Favorite Instant Mango Achaar Recipe #shorts #shraddhakapoor #achar #ashortaday
    April 27, 2026
    Bharti Singh's Favourite Healthy Makhana Icecream Recipe #kajukirasoi#bhartisingh #healthy Bharti Singh’s Favourite Healthy Makhana Icecream Recipe #kajukirasoi#bhartisingh #healthy
    April 27, 2026
    Previous Next
  • Low Calorie
    10 minits Breakfast#shortvideo #viralvideo #shortsvideo #shortsfeed #trending #ytshorts 10 minits Breakfast#shortvideo #viralvideo #shortsvideo #shortsfeed #trending #ytshorts
    April 27, 2026
    Low Calorie Sausage Egg & Cheese Breakfast Bagel That Changed My Life (High Protein Recipe Below) Low Calorie Sausage Egg & Cheese Breakfast Bagel That Changed My Life (High Protein Recipe Below)
    April 27, 2026
    What I eat in a day| high protein meals| calorie deficit #whatieatinaday #wieiad #lowcaloriefoods What I eat in a day| high protein meals| calorie deficit #whatieatinaday #wieiad #lowcaloriefoods
    April 26, 2026
    Let me know if you guys want more easy low calorie recipes!... #Shorts #paytonmey Let me know if you guys want more easy low calorie recipes!… #Shorts #paytonmey
    April 26, 2026
    High protein, low-calorie snack to fill you up on a calorie deficit. High protein, low-calorie snack to fill you up on a calorie deficit.
    April 26, 2026
    Previous Next
  • Salad
    Looking for a healthy, light and nutritious breakfast? Looking for a healthy, light and nutritious breakfast?
    April 27, 2026
    Special salad recipe!!! #salad #munchies #healthy #secret #food #yummy Special salad recipe!!! #salad #munchies #healthy #secret #food #yummy
    April 26, 2026
    Is pasta salad healthy?!? Is pasta salad healthy?!?
    April 26, 2026
    Healthy Vegetable Mix Salad Recipe.#recipe #food #shorts Healthy Vegetable Mix Salad Recipe.#recipe #food #shorts
    April 26, 2026
    Healthy Chatpata Noodles Salad Recipe #noodlesalad #salad #quickrecipe #easyrecipes #healthysnacks Healthy Chatpata Noodles Salad Recipe #noodlesalad #salad #quickrecipe #easyrecipes #healthysnacks
    April 26, 2026
    Previous Next
  • Bread
    Chocolate milk toast #viral #easy #chocolatebread #milkbread #humayeshakitchen #toast Chocolate milk toast #viral #easy #chocolatebread #milkbread #humayeshakitchen #toast
    April 27, 2026
    Make a tasty snack with aloo and bread|evening healthy snack recipe|try this recipe once | Make a tasty snack with aloo and bread|evening healthy snack recipe|try this recipe once |
    April 27, 2026
    Bread Pakoda With Air Fryer | #shorts #shortsvideo #youtubeshorts #poonamkinewkicthan Bread Pakoda With Air Fryer | #shorts #shortsvideo #youtubeshorts #poonamkinewkicthan
    April 27, 2026
    Learn Eggless Bread Online | Enrol at +91 91483-62124 Learn Eggless Bread Online | Enrol at +91 91483-62124
    April 27, 2026
    Raghav Chadha healthy almond mango shake recipe #shorts #viral #trending #raghavchadha #mangoshake Raghav Chadha healthy almond mango shake recipe #shorts #viral #trending #raghavchadha #mangoshake
    April 27, 2026
    Previous Next
  • Sandwich
    10 Minutes Healthy Breakfast Ideas | Easy Breakfast Recipes | Tiffin Recipes | Kids Lunchbox Ideas 10 Minutes Healthy Breakfast Ideas | Easy Breakfast Recipes | Tiffin Recipes | Kids Lunchbox Ideas
    April 27, 2026
    Mock Caesar Sandwich #iamondiet #veganrecipes #healthy #healthyfood #recipe #diyetteyim #food Mock Caesar Sandwich #iamondiet #veganrecipes #healthy #healthyfood #recipe #diyetteyim #food
    April 27, 2026
    tranding sandwich recipe #shailyhomekitchen #shortsfeed #indianfood #sandwich #healthy #ytshorts tranding sandwich recipe #shailyhomekitchen #shortsfeed #indianfood #sandwich #healthy #ytshorts
    April 27, 2026
    tranding daal sandwich healthy sandwich #shailyhomekitchen #indianfood #recipe #shorts #shortsfeed tranding daal sandwich healthy sandwich #shailyhomekitchen #indianfood #recipe #shorts #shortsfeed
    April 27, 2026
    Toast Recipe | Lunch Box Egg Toast Recipe | Healthy Bread Toast Recipe | Cheesy Bread Toast Recipe | Toast Recipe | Lunch Box Egg Toast Recipe | Healthy Bread Toast Recipe | Cheesy Bread Toast Recipe |
    April 27, 2026
    Previous Next
#friedcardababanana#sesame#shorts#subscribe #subscribers #recipe#easy#viral#howto#snack#healthy#food
Snacks

#friedcardababanana#sesame#shorts#subscribe #subscribers #recipe#easy#viral#howto#snack#healthy#food

By UCOOK October 7, 2022

@MCAB KITCHEN how to cook banana in a differennt way
#easy
#recipe
#foodie
#food
#snack

#friedbananarecipe#howtomakedessert#meryendarecipe#viraltodaybananasplitCuisinefriedcardababananasesameshortssubscribegooglehealthyHealthy CuisineHealthy Ideashealthy recipeshealthy snacksHealthy Snacks IdeasHealthy Snacks RecipeshowhowtohowtomakeideasreciperecipeeasyviralhowtosnackhealthyfoodshortssnacksSnacks IdeasSubscriberssweettrendingtrendingtodayVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.