UCOOK: Healthy Ideas
  • Recipes
    summer special recipe | sabudana mango recipe in Telugu | healthy recipes telugu summer special recipe | sabudana mango recipe in Telugu | healthy recipes telugu
    April 25, 2026
    Sweet Potato Recipe | Healthy & Tasty Shakarkandi Dish #shorts#shortsfeed #youtubeshorts #trending Sweet Potato Recipe | Healthy & Tasty Shakarkandi Dish #shorts#shortsfeed #youtubeshorts #trending
    April 24, 2026
    Gond Katira Drink | Super Healthy Drink #hikmattoday #recipe #umarhabibhijamacenter #food #health Gond Katira Drink | Super Healthy Drink #hikmattoday #recipe #umarhabibhijamacenter #food #health
    April 24, 2026
    Lunch box ideas #lunchbox #packmylunch #viralvideo #food #cooking #husband #lunch #love #foodie Lunch box ideas #lunchbox #packmylunch #viralvideo #food #cooking #husband #lunch #love #foodie
    April 24, 2026
    Overnight Oats| Easy 5 minutes Breakfast!Healthy Overnight Oats #weightloss Overnight Oats| Easy 5 minutes Breakfast!Healthy Overnight Oats #weightloss
    April 24, 2026
    Previous Next
  • Breakfast
    Breakfast ideas for a week |7 days 7 healthy breakfast options #healthyeating#balanceddiet #diet Breakfast ideas for a week |7 days 7 healthy breakfast options #healthyeating#balanceddiet #diet
    April 25, 2026
    How to make healthy breakfast recipes | Kitchen Set Diy Cooking Game Chef games | Android Gameplay How to make healthy breakfast recipes | Kitchen Set Diy Cooking Game Chef games | Android Gameplay
    April 25, 2026
    healthy breakfast recipe #virelshorts # true line # trending # shorts healthy breakfast recipe #virelshorts # true line # trending # shorts
    April 24, 2026
    HIGH PROTEIN WAFFLES  I Can't Stop Making! | Healthy Breakfast Idea HIGH PROTEIN WAFFLES I Can’t Stop Making! | Healthy Breakfast Idea
    April 24, 2026
    10 mins Wheat Flour healthy breakfast recipe | Quick & Easy Wheat flour recipes | Easy veg dinner 10 mins Wheat Flour healthy breakfast recipe | Quick & Easy Wheat flour recipes | Easy veg dinner
    April 24, 2026
    Previous Next
  • Lunch
    Morning Vlog & Costco Haul | Healthy Balanced Breakfast & Lunch Recipes|Must Have Kitchen Appliance Morning Vlog & Costco Haul | Healthy Balanced Breakfast & Lunch Recipes|Must Have Kitchen Appliance
    April 25, 2026
    Easy and healthy lunch idea for kids! #easy #lunch #healthy #budget #mealideas Easy and healthy lunch idea for kids! #easy #lunch #healthy #budget #mealideas
    April 24, 2026
    Tuna Pasta Salad   #healthy #cooking #lowcalorie #food #tuna #lunch #fyp #healthy #weightlossrecipe Tuna Pasta Salad #healthy #cooking #lowcalorie #food #tuna #lunch #fyp #healthy #weightlossrecipe
    April 24, 2026
    Healthy Work Lunch Idea Healthy Work Lunch Idea
    April 24, 2026
    Healthy Lunch Thali for 2 Yrs Old Baby #food #recipe #streetfood #baby #love #trending #shorts Healthy Lunch Thali for 2 Yrs Old Baby #food #recipe #streetfood #baby #love #trending #shorts
    April 24, 2026
    Previous Next
  • Dinner
    Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed
    April 25, 2026
    Sweet Heat Chicken & Rice High Protein Meal Prep Recipe #shorts Sweet Heat Chicken & Rice High Protein Meal Prep Recipe #shorts
    April 24, 2026
    Healthy Philly Cheese Steak Bowls #recipe #highprotein #easyrecipe Healthy Philly Cheese Steak Bowls #recipe #highprotein #easyrecipe
    April 24, 2026
    guest special yummy dessert ,Masala On Fire , #food ,#recipe ,#fyp  ,#cooking ,#delicious ,#healthy guest special yummy dessert ,Masala On Fire , #food ,#recipe ,#fyp ,#cooking ,#delicious ,#healthy
    April 24, 2026
    Healthy lunch ideas|#LahsuniPalak #IndianRecipes #ShortsCooking #DinnerIdeas Healthy lunch ideas|#LahsuniPalak #IndianRecipes #ShortsCooking #DinnerIdeas
    April 24, 2026
    Previous Next
  • Snacks
    2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort 2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort
    April 24, 2026
    Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings) Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings)
    April 24, 2026
    Breakfast series Day 5|kid's favourite Tiffin box Recipe #SteamyKitchenBells #viral #healthy #shorts Breakfast series Day 5|kid’s favourite Tiffin box Recipe #SteamyKitchenBells #viral #healthy #shorts
    April 24, 2026
    Watermelon Recipe|Watermelon Masala Stick|Summer Snacks|Popsicle#shorts #watermelon #viral #recipe Watermelon Recipe|Watermelon Masala Stick|Summer Snacks|Popsicle#shorts #watermelon #viral #recipe
    April 24, 2026
    oil free okra fry snacks in air fryer#trending #viral #health #easyrecipes oil free okra fry snacks in air fryer#trending #viral #health #easyrecipes
    April 24, 2026
    Previous Next
  • Weight Loss
    PCOS friendly | Weight loss | Healthy eating | Easy recipes | Health with Tilottama PCOS friendly | Weight loss | Healthy eating | Easy recipes | Health with Tilottama
    April 25, 2026
    High Protein Icecream Recipe By Nitesh Soni #healthy #summer #weightloss #recipe #banarasipaakshala High Protein Icecream Recipe By Nitesh Soni #healthy #summer #weightloss #recipe #banarasipaakshala
    April 24, 2026
    Protein Rich Weightloss Curry    #shorts #youtube #food #weightloss #viral #trending #shortvideo #yt Protein Rich Weightloss Curry #shorts #youtube #food #weightloss #viral #trending #shortvideo #yt
    April 24, 2026
    Pudina Saunf ka Sharbat #summerrecipes #saunfkasharbat #refreshingdrink #summerdrink #niteshsoni Pudina Saunf ka Sharbat #summerrecipes #saunfkasharbat #refreshingdrink #summerdrink #niteshsoni
    April 24, 2026
    Secrete Weight Loss Lunch ideas for Weight Loss #shorts #shortvideo #lunch #lunchboxideas Secrete Weight Loss Lunch ideas for Weight Loss #shorts #shortvideo #lunch #lunchboxideas
    April 24, 2026
    Previous Next
  • Low Calorie
    kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe
    April 25, 2026
    Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food
    April 24, 2026
    High protein & fiber wieiad High protein & fiber wieiad
    April 24, 2026
    Pete's Pasta - Review and Glucose Test Pete’s Pasta – Review and Glucose Test
    April 24, 2026
    Jackie Shroff Style Baingan Bharta #youtubeshorts #jackieshroffrecipe #healthyfood #bharta #recipe Jackie Shroff Style Baingan Bharta #youtubeshorts #jackieshroffrecipe #healthyfood #bharta #recipe
    April 24, 2026
    Previous Next
  • Salad
    Healthy habits by Dr tarang krishna | Sprouts salad recipe | #shortsvideo #healthylifestyle #easy Healthy habits by Dr tarang krishna | Sprouts salad recipe | #shortsvideo #healthylifestyle #easy
    April 25, 2026
    Healthy Salad #salad  #recipe Healthy Salad #salad #recipe
    April 25, 2026
    Healthy Chickpea Salad Recipe | Easy Protein Salad Healthy Chickpea Salad Recipe | Easy Protein Salad
    April 24, 2026
    2 minute Chickpeas Salad |Easy Breakfast Salad Recipe #shorts 2 minute Chickpeas Salad |Easy Breakfast Salad Recipe #shorts
    April 24, 2026
    Summer Salad #salad #summerrecipes #summersalad Summer Salad #salad #summerrecipes #summersalad
    April 24, 2026
    Previous Next
  • Bread
    Easy Snacks Recipe/Bread Pizza Sandwich Recipe/Healthy and Tasty Snacks#breakfastrecipe #evening Easy Snacks Recipe/Bread Pizza Sandwich Recipe/Healthy and Tasty Snacks#breakfastrecipe #evening
    April 25, 2026
    5 Minute Oat Bread (Recipe is 100 years old) 5 Minute Oat Bread (Recipe is 100 years old)
    April 24, 2026
    The #1 Healthiest Bread in the World. The #1 Healthiest Bread in the World.
    April 24, 2026
    Healthy Sourdough Bread | No Yeast French Baguettes Recipe Healthy Sourdough Bread | No Yeast French Baguettes Recipe
    April 24, 2026
    Healthy Cheesy Non fried Bread pakoda | Guilt Free  Tawa Bread Pakoda #trending #shorts #streetfood Healthy Cheesy Non fried Bread pakoda | Guilt Free Tawa Bread Pakoda #trending #shorts #streetfood
    April 24, 2026
    Previous Next
  • Sandwich
    Healthy 5 Min Easy Brown Bread Paneer  Sandwich Breakfast Recipe #shorts #breakfast #sandwich Healthy 5 Min Easy Brown Bread Paneer Sandwich Breakfast Recipe #shorts #breakfast #sandwich
    April 25, 2026
    celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts
    April 25, 2026
    Homemade Healthy Tandoori Paneer Sandwich Homemade Healthy Tandoori Paneer Sandwich
    April 25, 2026
    My Healthy Routine: Zero-Oil Meal, Quick Sandwich & Evening Vlog! My Healthy Routine: Zero-Oil Meal, Quick Sandwich & Evening Vlog!
    April 24, 2026
    Banana Milk Toast | Healthy Veg Sandwich | Sandwich Series | 4 of 7 #sandwich Banana Milk Toast | Healthy Veg Sandwich | Sandwich Series | 4 of 7 #sandwich
    April 24, 2026
    Previous Next
മുട്ടയും ബ്രഡ് ക്രംബ്‌സും കൊണ്ട് ഒരു പലഹാരം / CRISPY EGG BITES / evening snacks recipes in malayalam
Snacks

മുട്ടയും ബ്രഡ് ക്രംബ്‌സും കൊണ്ട് ഒരു പലഹാരം / CRISPY EGG BITES / evening snacks recipes in malayalam

By UCOOK December 9, 2019

#eveningsnacksrecipesinmalayalam
#Malayalamsnacks
#eggfingers
#crunchyeggfingers
#breadandeggsnacks

#easysnacks

Music:

Bitesbread and egg snacksCrispyCrispy egg bitescrunchy egg fingersCuisineeggegg fingersegg snacksEveningevening snacks recipes in malayalamhealthyHealthy CuisineHealthy Ideashealthy recipeshealthy snacksHealthy Snacks IdeasHealthy Snacks RecipesideasMalayalammalayalam snacksreciperecipesshamees kitchen bread ballsShamees kitchen bread snacksshamees kitchen snackssnacksSnacks IdeasVideoVlogYouTubeഒരകണടകരബസപലഹരബരഡമടടയ

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.