UCOOK: Healthy Ideas
  • Recipes
    Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer
    April 29, 2026
    3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy 3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy
    April 29, 2026
    #mealprep #healthyeating #healthyrecipes #healthyhabits #mealprep #healthyeating #healthyrecipes #healthyhabits
    April 29, 2026
    Biotin Laddu || Protein Laddu #shorts #youtubeshorts   #shortvideo #recipe #ytshorts #yt #healthy Biotin Laddu || Protein Laddu #shorts #youtubeshorts #shortvideo #recipe #ytshorts #yt #healthy
    April 29, 2026
    3 ingredient recipes kids actually eat #shorts #healthyrecipes #kidsfood 3 ingredient recipes kids actually eat #shorts #healthyrecipes #kidsfood
    April 29, 2026
    Previous Next
  • Breakfast
    Sweet Corn Poha! Kids favourite sweet corn poha recipe! healthy breakfast recipe #sweetcornpoha Sweet Corn Poha! Kids favourite sweet corn poha recipe! healthy breakfast recipe #sweetcornpoha
    April 29, 2026
    sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo
    April 29, 2026
    healthy breakfast recipe #shorts #shortsfeed #youtubeshorts #food #healthyfood #health healthy breakfast recipe #shorts #shortsfeed #youtubeshorts #food #healthyfood #health
    April 29, 2026
    Besan Ka Chilla Recipe | Healthy Breakfast in 10 Minutes#ytshorts #trending #shorts Besan Ka Chilla Recipe | Healthy Breakfast in 10 Minutes#ytshorts #trending #shorts
    April 29, 2026
    5 minute m banaya poha | easy breakfast recipe | 5 minute m banaya poha | easy breakfast recipe |
    April 29, 2026
    Previous Next
  • Lunch
    High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner's Recipe | Easy Hostel Recipes High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner’s Recipe | Easy Hostel Recipes
    April 29, 2026
    Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania
    April 29, 2026
    Quick Rajgira Paratha Recipe #food #toddlerfood #toddlerapproved Quick Rajgira Paratha Recipe #food #toddlerfood #toddlerapproved
    April 29, 2026
    Dal chawal benefits by Vedant sir#shorts #food #cooking #dalchawal #thali #lunch #healthy #viral Dal chawal benefits by Vedant sir#shorts #food #cooking #dalchawal #thali #lunch #healthy #viral
    April 29, 2026
    Kheera raita was made to escape the heat #shorts #heat #kheer #viral #food #recipe #cooking Kheera raita was made to escape the heat #shorts #heat #kheer #viral #food #recipe #cooking
    April 29, 2026
    Previous Next
  • Dinner
    Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes
    April 29, 2026
    #corn in #airfryer #philips #recipe #ytshorts #food #foodie #shorts #healthy #yummy #corn in #airfryer #philips #recipe #ytshorts #food #foodie #shorts #healthy #yummy
    April 29, 2026
    Drumstick Leaves Soup | Healthy Detox Soup Recipe Moringa soup #unique cooking # morning #recipe Drumstick Leaves Soup | Healthy Detox Soup Recipe Moringa soup #unique cooking # morning #recipe
    April 29, 2026
    Spicy Cucumber Salad #salad #cucumber #japanesefood #koreanfood #healthy #cooking #recipe #shorts Spicy Cucumber Salad #salad #cucumber #japanesefood #koreanfood #healthy #cooking #recipe #shorts
    April 29, 2026
    2 Minutes Recipe | raita recipe | banana recipe | #shorts #raita #momofhungrykids 2 Minutes Recipe | raita recipe | banana recipe | #shorts #raita #momofhungrykids
    April 29, 2026
    Previous Next
  • Snacks
    Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice
    April 29, 2026
    today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral
    April 29, 2026
    Sugar Free Sweets / sewai | Healthy Ramadan Iftar Sweet | Healthy Sweets | Healthy Sewairecipe Sugar Free Sweets / sewai | Healthy Ramadan Iftar Sweet | Healthy Sweets | Healthy Sewairecipe
    April 29, 2026
    Crispy Karela Chips | Healthy Snacks Crispy Karela Chips | Healthy Snacks
    April 29, 2026
    Bihar Makhana Snacks Recipe | Healthy Fox Nut Snack at Home #shorts #eveningsnacks #biharmakhana Bihar Makhana Snacks Recipe | Healthy Fox Nut Snack at Home #shorts #eveningsnacks #biharmakhana
    April 29, 2026
    Previous Next
  • Weight Loss
    Cucumber kimchi salad recipe |weight-loss recipe| Cucumber kimchi salad recipe |weight-loss recipe|
    April 29, 2026
    WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule
    April 29, 2026
    Low Calorie Carrot Noodles Salad | Healthy Weight Loss Recipe | Summer Salads | Easy Carrot Salad Low Calorie Carrot Noodles Salad | Healthy Weight Loss Recipe | Summer Salads | Easy Carrot Salad
    April 29, 2026
    healthy chana chaat #food #health #weightloss #shorts #youtubeshorts #cooking #ytshorts healthy chana chaat #food #health #weightloss #shorts #youtubeshorts #cooking #ytshorts
    April 29, 2026
    Stop Eating Regular Dosa Try This Healthy High Protein Dosa #shorts #youtubeshorts #weightloss #dosa Stop Eating Regular Dosa Try This Healthy High Protein Dosa #shorts #youtubeshorts #weightloss #dosa
    April 29, 2026
    Previous Next
  • Low Calorie
    Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes
    April 29, 2026
    5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet 5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet
    April 29, 2026
    #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss
    April 29, 2026
    “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food
    April 29, 2026
    Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food
    April 29, 2026
    Previous Next
  • Salad
    Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts
    April 29, 2026
    5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad 5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad
    April 29, 2026
    Cucumber and carrot healthy salad. #handmadefood #recipe #easyrecipe #viral #shorts Cucumber and carrot healthy salad. #handmadefood #recipe #easyrecipe #viral #shorts
    April 29, 2026
    Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees | Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees |
    April 29, 2026
    healthy salad recipe #ytshorts #youtubeshorts #fyp #explore #trending #cooking #recipe #foryou healthy salad recipe #ytshorts #youtubeshorts #fyp #explore #trending #cooking #recipe #foryou
    April 29, 2026
    Previous Next
  • Bread
    Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts
    April 29, 2026
    bread cutlet recipe#trending #food #healthy#snacksshorts bread cutlet recipe#trending #food #healthy#snacksshorts
    April 29, 2026
    Bread flower pizza |easy tasty recipes #foodie #shorts #healthy Bread flower pizza |easy tasty recipes #foodie #shorts #healthy
    April 29, 2026
    Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box
    April 29, 2026
    The BEST chocolate banana bread ever!! | Healthy baking The BEST chocolate banana bread ever!! | Healthy baking
    April 28, 2026
    Previous Next
  • Sandwich
    Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs
    April 29, 2026
    Ankurit Sandwich Healthy Bhi Tasty Bhi  #sandwich #streetfood #jaipurfood #shorts #viral #trending Ankurit Sandwich Healthy Bhi Tasty Bhi #sandwich #streetfood #jaipurfood #shorts #viral #trending
    April 29, 2026
    Instant Morning Breakfast Recipes | Tiffin Recipes | Healthy Kids Lunchbox | Easy Breakfast Recipe Instant Morning Breakfast Recipes | Tiffin Recipes | Healthy Kids Lunchbox | Easy Breakfast Recipe
    April 29, 2026
    Healthy breakfast recipes#viralvideo #shortvideo #shortsfeed #shorts #trending #ytshorts Healthy breakfast recipes#viralvideo #shortvideo #shortsfeed #shorts #trending #ytshorts
    April 29, 2026
    Cafe Style Panner Veg Sandwich | Sandwich Recipe | Cafe Style Panner Veg Sandwich | Sandwich Recipe |
    April 29, 2026
    Previous Next
Ghee vali roti #shortsytvideo #shorts #lunch #healthy roti
Bread

Ghee vali roti #shortsytvideo #shorts #lunch #healthy roti

By UCOOK January 15, 2025



Ghee vali roti #shortsytvideo #shorts #lunch #healthy roti
@Tanykitchen

BreadBread IdeasBread RecipesCuisineGheehealthyHealthy BreadHealthy Bread IdeasHealthy Bread RecipesHealthy CuisineHealthy Ideashealthy recipesideaslunchnimmyvegkitchenrecipereciperotishortsshortsytvideovaliVideoVlogYouTubeytubeshorts

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.