UCOOK: Healthy Ideas
  • Recipes
    Viral cheese maggi recipe..with a healthy twist #shorts #cheesemacaroni #healthy #cloudkitchen Viral cheese maggi recipe..with a healthy twist #shorts #cheesemacaroni #healthy #cloudkitchen
    March 9, 2026
    #indi5 Minute Instant  Recipe | Healthy Breakfastanfoodmadeeasy #recipe phoh #indi5 Minute Instant Recipe | Healthy Breakfastanfoodmadeeasy #recipe phoh
    March 9, 2026
    Natural Immunity Boosting Juice #shorts #detoxjuice #healthyrecipes Natural Immunity Boosting Juice #shorts #detoxjuice #healthyrecipes
    March 9, 2026
    Viral Healthy Makhana chaat recipe #viral #shorts #shortsfeed #makhanachaat #healthy Viral Healthy Makhana chaat recipe #viral #shorts #shortsfeed #makhanachaat #healthy
    March 9, 2026
    Thyroid friendly Recipe | Bottle gourd with Coconut Milk | Healthy Recipes | Bottle gourd Recipes Thyroid friendly Recipe | Bottle gourd with Coconut Milk | Healthy Recipes | Bottle gourd Recipes
    March 9, 2026
    Previous Next
  • Breakfast
    Easy way to make Paratha for sehri#trending Easy way to make Paratha for sehri#trending
    March 9, 2026
    Kesar Pista Overnight Oats | High Protein High Fiber Breakfast #shorts #oats Kesar Pista Overnight Oats | High Protein High Fiber Breakfast #shorts #oats
    March 9, 2026
    Easy breakfast ideas #shorts #paratha #breakfast #kitchen #cooking #rdlifestyle Easy breakfast ideas #shorts #paratha #breakfast #kitchen #cooking #rdlifestyle
    March 8, 2026
    healthy breakfast ideas for the week #breakfastideas #healthyeating #wieiadhealthy healthy breakfast ideas for the week #breakfastideas #healthyeating #wieiadhealthy
    March 8, 2026
    Power Protein Overnight Oats | Healthy 5-Minute Breakfast #shorts #viral #trending #ytshorts Power Protein Overnight Oats | Healthy 5-Minute Breakfast #shorts #viral #trending #ytshorts
    March 8, 2026
    Previous Next
  • Lunch
    Beefy Queso Burrito High Protein Meal Prep Recipe #shorts Beefy Queso Burrito High Protein Meal Prep Recipe #shorts
    March 9, 2026
    Lunch recipe: Rice n sundakkai kulambu | egg burji | sweet #shortsfeed #lunchideas #lunchbox Lunch recipe: Rice n sundakkai kulambu | egg burji | sweet #shortsfeed #lunchideas #lunchbox
    March 9, 2026
    Creamy Paneer Rice Bowl | Healthy Lunch recipes | High protein meals | Paneer recipes #recipe Creamy Paneer Rice Bowl | Healthy Lunch recipes | High protein meals | Paneer recipes #recipe
    March 9, 2026
    Kids Lunch Box Ideas That Are Healthy & Fun Kids Lunch Box Ideas That Are Healthy & Fun
    March 9, 2026
    Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe
    March 9, 2026
    Previous Next
  • Dinner
    Easy healthy dinner idea #foodcontentcreator #foodugc #ugccommunity #microinfluencer #foodcontent Easy healthy dinner idea #foodcontentcreator #foodugc #ugccommunity #microinfluencer #foodcontent
    March 9, 2026
    healthy dinner inspo #gymgirl #dinnerideas #food healthy dinner inspo #gymgirl #dinnerideas #food
    March 9, 2026
    Easy week night dinner idea - healthy & tasty  #dinner #recipe #shorts #healthyrecipes Easy week night dinner idea – healthy & tasty #dinner #recipe #shorts #healthyrecipes
    March 9, 2026
    HEALTHY MEALS IN 15 MINUTES - Anda bhurji, full video on my channel #shorts #15minutemeals HEALTHY MEALS IN 15 MINUTES – Anda bhurji, full video on my channel #shorts #15minutemeals
    March 9, 2026
    Healthy Weightloss Dinner Recipes Healthy Weightloss Dinner Recipes
    March 9, 2026
    Previous Next
  • Snacks
    Crispy Air Fryer Pasta Chips | The Ultimate Viral Snack! #PastaChips #AirFryerRecipes #ViralSnack Crispy Air Fryer Pasta Chips | The Ultimate Viral Snack! #PastaChips #AirFryerRecipes #ViralSnack
    March 9, 2026
    Healthy tiffin ideas for kids/OATS SPROUTS PANEER,Lunchbox recipes/ Breakfast/Snacks tiffin recipes Healthy tiffin ideas for kids/OATS SPROUTS PANEER,Lunchbox recipes/ Breakfast/Snacks tiffin recipes
    March 9, 2026
    Healthy Snacks Recipe #shorts #viral #trending #food #recipe #shortvideo Healthy Snacks Recipe #shorts #viral #trending #food #recipe #shortvideo
    March 9, 2026
    Mint flavour Makhana | weight loss friendly #healthysnacks #weightloss #easytomake #makhana Mint flavour Makhana | weight loss friendly #healthysnacks #weightloss #easytomake #makhana
    March 9, 2026
    No Bake Homemade Protein Bars | Healthy Oats Peanut Butter Snack | High Protein Snack No Bake Homemade Protein Bars | Healthy Oats Peanut Butter Snack | High Protein Snack
    March 9, 2026
    Previous Next
  • Weight Loss
    High Protein Pizza No Maida No Oven Sprouts Pizza for Weight Loss and Kids Friendly #shorts #pizza High Protein Pizza No Maida No Oven Sprouts Pizza for Weight Loss and Kids Friendly #shorts #pizza
    March 9, 2026
    Black Rice Porridge #weightloss #viral #short #shorts #viralshorts #shortvideo #youtubeshorts Black Rice Porridge #weightloss #viral #short #shorts #viralshorts #shortvideo #youtubeshorts
    March 9, 2026
    vegetable moonglet //a healthy breakfast //lunch recipe #trending #health #weightloss #shorts vegetable moonglet //a healthy breakfast //lunch recipe #trending #health #weightloss #shorts
    March 8, 2026
    Millet upma , Weightloss friendly, Diabetic friendly. Full recipe is in description by Millet upma , Weightloss friendly, Diabetic friendly. Full recipe is in description by
    March 8, 2026
    Weight Loss Special Daliya Upma | High Fiber Healthy Meal #shorts #food #recipe #cooking #viral Weight Loss Special Daliya Upma | High Fiber Healthy Meal #shorts #food #recipe #cooking #viral
    March 8, 2026
    Previous Next
  • Low Calorie
    Low calorie high protein chicken crust pizza - easy healthy dinner Low calorie high protein chicken crust pizza – easy healthy dinner
    March 8, 2026
    Chinese Takeout Under 600 Calories (Weight Loss Hack) Chinese Takeout Under 600 Calories (Weight Loss Hack)
    March 8, 2026
    Subah Khali Pet Lauki Juice?RamdevBaba Health Secrets | Bottle Gourd JuiceBenefits #shorts #fyp Subah Khali Pet Lauki Juice?RamdevBaba Health Secrets | Bottle Gourd JuiceBenefits #shorts #fyp
    March 8, 2026
    My Favorite Low Calorie Ingredients for Losing Fat (25 Recipes) My Favorite Low Calorie Ingredients for Losing Fat (25 Recipes)
    March 8, 2026
    Healthy Zucchini Cutlets | Low Calorie Snack for Weight Loss Healthy Zucchini Cutlets | Low Calorie Snack for Weight Loss
    March 8, 2026
    Previous Next
  • Salad
    l Healthy protein veg salad |Simple Diet Veg Salad | Super Healthy Recipe #shorts l Healthy protein veg salad |Simple Diet Veg Salad | Super Healthy Recipe #shorts
    March 9, 2026
    Healthy Protein Snack | High Protein Orange Chickpea Salad  #salad #healthyrecipes #recipe #food #yt Healthy Protein Snack | High Protein Orange Chickpea Salad #salad #healthyrecipes #recipe #food #yt
    March 9, 2026
    healthy salad recipe #youtubeshorts #viralshorts #saladrecipe healthy salad recipe #youtubeshorts #viralshorts #saladrecipe
    March 9, 2026
    Comment “salad” below and l will send you the printable recipe! Comment “salad” below and l will send you the printable recipe!
    March 9, 2026
    Easy Matki Sprouts Salad |Instant Healthy Salad Recipe#salad #sprout #shorts Easy Matki Sprouts Salad |Instant Healthy Salad Recipe#salad #sprout #shorts
    March 9, 2026
    Previous Next
  • Bread
    Easy And Healthy Breakfast Ideas For Tiffin | Kids Lunchbox Recipes | Tiffin Recipes | Lunch Box Easy And Healthy Breakfast Ideas For Tiffin | Kids Lunchbox Recipes | Tiffin Recipes | Lunch Box
    March 9, 2026
    Easy Healthy Breakfast in 5mins | High Protein Breakfast/Snacks Recipes | Jhatpatkitchenecipes Easy Healthy Breakfast in 5mins | High Protein Breakfast/Snacks Recipes | Jhatpatkitchenecipes
    March 9, 2026
    Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe Stop Eating Junk Food! Try this Healthy Vegetarian Recipes Indian | Kids Tiffin Box Breakfast Recipe
    March 9, 2026
    Meeru epudaina Green Sauce Presto Pasta try chesara?? #youtubeshorts #ytshorts Meeru epudaina Green Sauce Presto Pasta try chesara?? #youtubeshorts #ytshorts
    March 9, 2026
    Bread without flour or eggs! Just take a cup of chickpeas and flax seeds! Lots of protein! Bread without flour or eggs! Just take a cup of chickpeas and flax seeds! Lots of protein!
    March 9, 2026
    Previous Next
  • Sandwich
    3 WAYS TO BREAK UP WITH CONVENIENCE FOODS 3 WAYS TO BREAK UP WITH CONVENIENCE FOODS
    March 9, 2026
    Paneer Sandwich/Paneer veg sandwich#sandwich#recipe#paneer#iftarrecipe#ramzan#yt#healthy#vegetables Paneer Sandwich/Paneer veg sandwich#sandwich#recipe#paneer#iftarrecipe#ramzan#yt#healthy#vegetables
    March 9, 2026
    Sandwich Recipe Without Bread | Nasta Recipe #shorts #youtubeshorts #trending #sandwich Sandwich Recipe Without Bread | Nasta Recipe #shorts #youtubeshorts #trending #sandwich
    March 9, 2026
    Alfredo pasta and pesto sandwich | tasty healthy #thefoodplateform #recipe Alfredo pasta and pesto sandwich | tasty healthy #thefoodplateform #recipe
    March 9, 2026
    5 minutes easy and healthy sandwich #iftar #shorts 5 minutes easy and healthy sandwich #iftar #shorts
    March 9, 2026
    Previous Next
Healthy Protein Sandwich Recipe l Sports Nutritionist Siddhant Sule l QUA Nutrition
Bread

Healthy Protein Sandwich Recipe l Sports Nutritionist Siddhant Sule l QUA Nutrition

By UCOOK February 3, 2023

Life is like a sandwich, you have to fill it with the best ingredients.. 🙂

Protein Sandwich 🥪

Ingredients
– Multigrain Bread
– Mint Chutney
– Onions
– Tomatoes 🍅
– Cucumber 🥒
– Beetroot
– Boiled eggs 🥚
– Cheese

BeetrootBreadBread IdeasBread RecipescheeseCucumberCuisinecustomizeddietplaneggsandwichhealthyHealthy BreadHealthy Bread IdeasHealthy Bread RecipesHealthy CuisineHealthy Ideashealthy recipeshealthybreakfastsandwichrecipeshealthyproteinrecipesideasnutritionnutritionistproteinproteinsandwichproteinsourceforvegetariansquảquanutritionquanutritionpersonalizeddietplanreciperecipeshortssandwichsaturdaysnacksSiddhantsiddhantsulesnacksSnackTimesportssportsnutritionSuletomatoVideoVlogYouTubeyoutubefoodshorts

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.