UCOOK: Healthy Ideas
  • Recipes
    Upma ku Cravings ah #ravaupma #healthyrecipes Upma ku Cravings ah #ravaupma #healthyrecipes
    April 25, 2026
    No Maida No Sugar Cake | Healthy Cake Recipe for Weight Loss & Clean Eating Easy Guilt-Free Dessert No Maida No Sugar Cake | Healthy Cake Recipe for Weight Loss & Clean Eating Easy Guilt-Free Dessert
    April 25, 2026
    Black chickpeas kebab recipe full with protein and fibre #kababrecipe #shorts #recipe #viral#healthy Black chickpeas kebab recipe full with protein and fibre #kababrecipe #shorts #recipe #viral#healthy
    April 25, 2026
    turai ki sabzi #short#trending #plastine #healthyrecipes turai ki sabzi #short#trending #plastine #healthyrecipes
    April 25, 2026
    summer special recipe | sabudana mango recipe in Telugu | healthy recipes telugu summer special recipe | sabudana mango recipe in Telugu | healthy recipes telugu
    April 25, 2026
    Previous Next
  • Breakfast
    Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts
    April 25, 2026
    healthy breakfast ideas...... healthy breakfast ideas……
    April 25, 2026
    Breakfast ideas for a week |7 days 7 healthy breakfast options #healthyeating#balanceddiet #diet Breakfast ideas for a week |7 days 7 healthy breakfast options #healthyeating#balanceddiet #diet
    April 25, 2026
    Green Moong Dal Dosa | Healthy Breakfast with Curd #breakfastideas #healthybreakfast #easytomake Green Moong Dal Dosa | Healthy Breakfast with Curd #breakfastideas #healthybreakfast #easytomake
    April 25, 2026
    How to make healthy breakfast recipes | Kitchen Set Diy Cooking Game Chef games | Android Gameplay How to make healthy breakfast recipes | Kitchen Set Diy Cooking Game Chef games | Android Gameplay
    April 25, 2026
    Previous Next
  • Lunch
    Morning Vlog & Costco Haul | Healthy Balanced Breakfast & Lunch Recipes|Must Have Kitchen Appliance Morning Vlog & Costco Haul | Healthy Balanced Breakfast & Lunch Recipes|Must Have Kitchen Appliance
    April 25, 2026
    Easy and healthy lunch idea for kids! #easy #lunch #healthy #budget #mealideas Easy and healthy lunch idea for kids! #easy #lunch #healthy #budget #mealideas
    April 24, 2026
    Tuna Pasta Salad   #healthy #cooking #lowcalorie #food #tuna #lunch #fyp #healthy #weightlossrecipe Tuna Pasta Salad #healthy #cooking #lowcalorie #food #tuna #lunch #fyp #healthy #weightlossrecipe
    April 24, 2026
    Healthy Work Lunch Idea Healthy Work Lunch Idea
    April 24, 2026
    Healthy Lunch Thali for 2 Yrs Old Baby #food #recipe #streetfood #baby #love #trending #shorts Healthy Lunch Thali for 2 Yrs Old Baby #food #recipe #streetfood #baby #love #trending #shorts
    April 24, 2026
    Previous Next
  • Dinner
    Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed Junk Food Health Risk Acharya Manishji Healthy Tips #abc #abcjuice#recipe #shortsfeed
    April 25, 2026
    moog daal instant dosa perfect #recipe #healthy #viral moog daal instant dosa perfect #recipe #healthy #viral
    April 25, 2026
    #quickrecipe #morning #breakfast #healthy #chilla #recipe #love #shorts#viral #quickrecipe #morning #breakfast #healthy #chilla #recipe #love #shorts#viral
    April 25, 2026
    Sweet Heat Chicken & Rice High Protein Meal Prep Recipe #shorts Sweet Heat Chicken & Rice High Protein Meal Prep Recipe #shorts
    April 24, 2026
    Healthy Philly Cheese Steak Bowls #recipe #highprotein #easyrecipe Healthy Philly Cheese Steak Bowls #recipe #highprotein #easyrecipe
    April 24, 2026
    Previous Next
  • Snacks
    Unique Mudhi Cutlet by Rosys Kitchen | You’ve Never Tasted Puffed Rice Like This Before! Unique Mudhi Cutlet by Rosys Kitchen | You’ve Never Tasted Puffed Rice Like This Before!
    April 25, 2026
    2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort 2 Min Healthy Sandwich| No Mayo Recipe | Diet Sandwich | GreenChutney recipe#shortvideo#youtubeshort
    April 24, 2026
    Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings) Healthy Snack: Crispy Chickpeas That Actually Fill You Up (High Fiber Option for Snack and Toppings)
    April 24, 2026
    Breakfast series Day 5|kid's favourite Tiffin box Recipe #SteamyKitchenBells #viral #healthy #shorts Breakfast series Day 5|kid’s favourite Tiffin box Recipe #SteamyKitchenBells #viral #healthy #shorts
    April 24, 2026
    Watermelon Recipe|Watermelon Masala Stick|Summer Snacks|Popsicle#shorts #watermelon #viral #recipe Watermelon Recipe|Watermelon Masala Stick|Summer Snacks|Popsicle#shorts #watermelon #viral #recipe
    April 24, 2026
    Previous Next
  • Weight Loss
    Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe
    April 25, 2026
    PCOS friendly | Weight loss | Healthy eating | Easy recipes | Health with Tilottama PCOS friendly | Weight loss | Healthy eating | Easy recipes | Health with Tilottama
    April 25, 2026
    High Protein Soya Chunks Salad |Soya Chunks Recipe #healthyfitbyte #shorts #weightloss High Protein Soya Chunks Salad |Soya Chunks Recipe #healthyfitbyte #shorts #weightloss
    April 25, 2026
    #weightloss #weightlossjourney #lowcarb #mealreplacement #CSEpartner #weightloss #weightlossjourney #lowcarb #mealreplacement #CSEpartner
    April 24, 2026
    High Protein Icecream Recipe By Nitesh Soni #healthy #summer #weightloss #recipe #banarasipaakshala High Protein Icecream Recipe By Nitesh Soni #healthy #summer #weightloss #recipe #banarasipaakshala
    April 24, 2026
    Previous Next
  • Low Calorie
    Dr Manishaa's Secrets For Naturally Glowing & Shiny Skin! #easyrecipe  #glowingskin Dr Manishaa’s Secrets For Naturally Glowing & Shiny Skin! #easyrecipe #glowingskin
    April 25, 2026
    Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak
    April 25, 2026
    kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe
    April 25, 2026
    Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food Entire Jar of Salad Dressing for 136 calories! #weightloss #lowcalorie #healthyswaps #mealprep #food
    April 24, 2026
    High protein & fiber wieiad High protein & fiber wieiad
    April 24, 2026
    Previous Next
  • Salad
    Healthy habits by Dr tarang krishna | Sprouts salad recipe | #shortsvideo #healthylifestyle #easy Healthy habits by Dr tarang krishna | Sprouts salad recipe | #shortsvideo #healthylifestyle #easy
    April 25, 2026
    Healthy Salad #salad  #recipe Healthy Salad #salad #recipe
    April 25, 2026
    Ensalada saludable con un toque de fresas. #ensalada #alimentossanos #recetas Ensalada saludable con un toque de fresas. #ensalada #alimentossanos #recetas
    April 25, 2026
    Healthy Chickpea Salad Recipe | Easy Protein Salad Healthy Chickpea Salad Recipe | Easy Protein Salad
    April 24, 2026
    2 minute Chickpeas Salad |Easy Breakfast Salad Recipe #shorts 2 minute Chickpeas Salad |Easy Breakfast Salad Recipe #shorts
    April 24, 2026
    Previous Next
  • Bread
    coconut mango tadgola cooler, a refreshing summer drink #shorts #coconut #summerdrink coconut mango tadgola cooler, a refreshing summer drink #shorts #coconut #summerdrink
    April 25, 2026
    Healthy Bread Omelette | Quick Breakfast in 10-Mins | High Protein Yummy Weight Loss Breakfast Idea Healthy Bread Omelette | Quick Breakfast in 10-Mins | High Protein Yummy Weight Loss Breakfast Idea
    April 25, 2026
    Quick and Healthy Breakfast Ideas | Kids Lunch Box | Tiffin Recipes | Breakfast Recipe | Breakfast Quick and Healthy Breakfast Ideas | Kids Lunch Box | Tiffin Recipes | Breakfast Recipe | Breakfast
    April 25, 2026
    Healthy Bread Sandwich Recipe #recipe #trendingshorts #viralrecipe #breakfastsandwich Healthy Bread Sandwich Recipe #recipe #trendingshorts #viralrecipe #breakfastsandwich
    April 25, 2026
    No Bread No Maida High Protein Veg Breakfast Recipe | Easy & Healthy Kids Lunch Box Recipe || No Bread No Maida High Protein Veg Breakfast Recipe | Easy & Healthy Kids Lunch Box Recipe ||
    April 25, 2026
    Previous Next
  • Sandwich
    Healthy 5 Min Easy Brown Bread Paneer  Sandwich Breakfast Recipe #shorts #breakfast #sandwich Healthy 5 Min Easy Brown Bread Paneer Sandwich Breakfast Recipe #shorts #breakfast #sandwich
    April 25, 2026
    celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts
    April 25, 2026
    Homemade Healthy Tandoori Paneer Sandwich Homemade Healthy Tandoori Paneer Sandwich
    April 25, 2026
    My Healthy Routine: Zero-Oil Meal, Quick Sandwich & Evening Vlog! My Healthy Routine: Zero-Oil Meal, Quick Sandwich & Evening Vlog!
    April 24, 2026
    Banana Milk Toast | Healthy Veg Sandwich | Sandwich Series | 4 of 7 #sandwich Banana Milk Toast | Healthy Veg Sandwich | Sandwich Series | 4 of 7 #sandwich
    April 24, 2026
    Previous Next
3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱
Breakfast

3 EASY & HEALTHY BREAKFAST IDEAS | Vegan 🌱

By UCOOK March 6, 2020

Here are 3 easy and healthy vegan breakfast ideas! I hope this can be helpful to you if your stuck on what to make for breakfast!

CHECK OUT MY LAST VIDEO-

Thank you so much for watching and please let me know what you would like to see next!

Please press that LIKE button if you want me to make more videos like this and SUBSCRIBE because you wont want to miss my next video silly billy!!

Lets grow vegan together !

#Healthybreakfastideas3easyhealthybreakfastideas3easyhealthyveganbreakfastideasampBreakfastbreakfast ideasCuisinedairyfreebreakfasteasyeasyhealthybreakfasteasyhealthybreakfastideaseasyveganbreakfasteasyveganmealemmachaimberlainfunnyveganhealthyhealthy breakfastHealthy Breakfast IdeasHealthy Breakfast RecipesHealthy CuisineHealthy Ideashealthy recipeshealthyveganbreakfasthealthyveganmealhowtobeveganhowtoeatveganideasnataliewislerplantbasedbreakfastquickveganbreakfastquickveganmealquickveganrecipiesrecipesimpleveganbreakfastsupremebananatransitioningveganveganveganbananarecipieveganbreakfastveganbreakfastsmoothieveganovernightoastVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.