UCOOK: Healthy Ideas
  • Recipes
    Healthy Juice #healthyjuice #human #bodyparts#beetrootbenefits #shorts #ytshorts Healthy Juice #healthyjuice #human #bodyparts#beetrootbenefits #shorts #ytshorts
    February 8, 2026
    Boost your digestion, manage blood sugar, with this natural remedy #viralvedio #shorts #viralvideos Boost your digestion, manage blood sugar, with this natural remedy #viralvedio #shorts #viralvideos
    February 8, 2026
    #weightloss #smoothie #healthyrecipes  #weightlosstips #weightlosstransformation #shorts #fyp #weightloss #smoothie #healthyrecipes #weightlosstips #weightlosstransformation #shorts #fyp
    February 8, 2026
    Make chickpea blondies with me! #baking #healthyrecipes #healthylifestyle #healthybaking Make chickpea blondies with me! #baking #healthyrecipes #healthylifestyle #healthybaking
    February 7, 2026
    2 healthy drink #food #ayurved #recipe #cooking #health #shortsfeed 2 healthy drink #food #ayurved #recipe #cooking #health #shortsfeed
    February 7, 2026
    Previous Next
  • Breakfast
    Best Tips For Making Moongfali Chaat Recipe || Healthy Breakfast Recipe #shorts #shortvideo #cooking Best Tips For Making Moongfali Chaat Recipe || Healthy Breakfast Recipe #shorts #shortvideo #cooking
    February 8, 2026
    Healthy Chocolate Pancake recipe | Healthy breakfast ideas | High protein recipes | Pancakes Healthy Chocolate Pancake recipe | Healthy breakfast ideas | High protein recipes | Pancakes
    February 8, 2026
    #216 Healthy breakfast #recipe #karuppukavuni #kanji #shorts #216 Healthy breakfast #recipe #karuppukavuni #kanji #shorts
    February 8, 2026
    2 drops Oil Healthy Breakfast Recipe #shorts 2 drops Oil Healthy Breakfast Recipe #shorts
    February 8, 2026
    healthy breakfast recipe by Acharya Manish ji#healthylifestyle#shorts#shortvideo#short healthy breakfast recipe by Acharya Manish ji#healthylifestyle#shorts#shortvideo#short
    February 8, 2026
    Previous Next
  • Lunch
    Beetroot Bethua Lachha Paratha Recipe | Chukander Winter Special #shorts #viral #trending #paratha Beetroot Bethua Lachha Paratha Recipe | Chukander Winter Special #shorts #viral #trending #paratha
    February 8, 2026
    Tawa bhindi recipe | Bhindi ki sabji recipe | #shortsfeed Tawa bhindi recipe | Bhindi ki sabji recipe | #shortsfeed
    February 8, 2026
    Bread recipe day-6 Veggies sandwich #healthy #food #shorts Bread recipe day-6 Veggies sandwich #healthy #food #shorts
    February 8, 2026
    Benefits of Guava by Dr. Robin Sharma #food #healthyfood #health #fruit #guava #recipe #tips Benefits of Guava by Dr. Robin Sharma #food #healthyfood #health #fruit #guava #recipe #tips
    February 8, 2026
    Healthy Chicken Rice Bowl #shorts #shortsfeed #chicken #healthy #lunch #viral #weightloss #trending Healthy Chicken Rice Bowl #shorts #shortsfeed #chicken #healthy #lunch #viral #weightloss #trending
    February 8, 2026
    Previous Next
  • Dinner
    Matar ki Ghugri #food  #cooking  #recipe  #shortvideo  #ytshort  #youtubeshorts Matar ki Ghugri #food #cooking #recipe #shortvideo #ytshort #youtubeshorts
    February 8, 2026
    15 Minute Healthy Snack | Bache Hue Rice Se Easy & Tasty Recipe#tastyfood #ricerecip #healthy#tasty 15 Minute Healthy Snack | Bache Hue Rice Se Easy & Tasty Recipe#tastyfood #ricerecip #healthy#tasty
    February 8, 2026
    Beetroot Paneer Tikki with Curd Dip | Easiest Healthy Dinner Recipe | CookWithSushma Beetroot Paneer Tikki with Curd Dip | Easiest Healthy Dinner Recipe | CookWithSushma
    February 8, 2026
    Boost your immunity+tasty#ytshorts #amlaachar#shortsvideo#recipe #aromaticfood#healthy#winterspecial Boost your immunity+tasty#ytshorts #amlaachar#shortsvideo#recipe #aromaticfood#healthy#winterspecial
    February 8, 2026
    Turn Leftover Rice Into High Protein Healthy Rice #healthy #food #recipe #viral #shorts #viralvideo Turn Leftover Rice Into High Protein Healthy Rice #healthy #food #recipe #viral #shorts #viralvideo
    February 8, 2026
    Previous Next
  • Snacks
    Fish fry #healthy #snacks #fish #ramadan #food #shortsfeed #yt #trending #foodie #iftar #cooking Fish fry #healthy #snacks #fish #ramadan #food #shortsfeed #yt #trending #foodie #iftar #cooking
    February 8, 2026
    Aaj sirf do chijo se ghar pe healthy snacks banaen #minivlog #shortvideo#recipes #food #newvlog Aaj sirf do chijo se ghar pe healthy snacks banaen #minivlog #shortvideo#recipes #food #newvlog
    February 8, 2026
    Healthy Sprouts Moong Chaat Recipe #youtubeshorts #shortsfeed #sprout Healthy Sprouts Moong Chaat Recipe #youtubeshorts #shortsfeed #sprout
    February 8, 2026
    Healthy Namkeen in Airfryer #shorts #recipe #airfryerrecipes #healthysnacks Healthy Namkeen in Airfryer #shorts #recipe #airfryerrecipes #healthysnacks
    February 8, 2026
    shorts indian healthy snacks #recipe #foodytviralvidio shorts indian healthy snacks #recipe #foodytviralvidio
    February 7, 2026
    Previous Next
  • Weight Loss
    Healthy Beetroot Salad Recipe for Weight Loss | High Protein Paneer Chole Salad | Easy Diet Salad Healthy Beetroot Salad Recipe for Weight Loss | High Protein Paneer Chole Salad | Easy Diet Salad
    February 8, 2026
    super super healthy breakfast for weight loss in one month #recipe #food #nutritionhack #healthdiet super super healthy breakfast for weight loss in one month #recipe #food #nutritionhack #healthdiet
    February 8, 2026
    Easy Way to Hit 50g Protein #nutritiontips#proteinsnack#weightloss#shorts#proteindiet Easy Way to Hit 50g Protein #nutritiontips#proteinsnack#weightloss#shorts#proteindiet
    February 8, 2026
    Super Simple, 3 Ingredient Chili #healthy #weightloss #recipe #plantbased Super Simple, 3 Ingredient Chili #healthy #weightloss #recipe #plantbased
    February 7, 2026
    Weightloss Transformation Weightloss Transformation
    February 7, 2026
    Previous Next
  • Low Calorie
    Paneer Salad bowl | Super healthy & Low calorie | Protenicious diet recepie | Paneer Salad bowl | Super healthy & Low calorie | Protenicious diet recepie |
    February 8, 2026
    Gud Imli ki Chutney Recipe | Ramzan Special Chutney for chaat #iftarspecial #ramadan #imlikichatni Gud Imli ki Chutney Recipe | Ramzan Special Chutney for chaat #iftarspecial #ramadan #imlikichatni
    February 8, 2026
    Kim's Magic Pop Snack Review Tasting 6 Delicious Packs of Healthy Popped Grains #SnackReview Kim’s Magic Pop Snack Review Tasting 6 Delicious Packs of Healthy Popped Grains #SnackReview
    February 7, 2026
    Taste Test: Low-Calorie High-Protein Lemon Chicken Bowl (So Good) Taste Test: Low-Calorie High-Protein Lemon Chicken Bowl (So Good)
    February 7, 2026
    Healthy breakfast recipe #food #recipe #healthybreakefast #viral #reels #shorts #shortsvideo #viral Healthy breakfast recipe #food #recipe #healthybreakefast #viral #reels #shorts #shortsvideo #viral
    February 7, 2026
    Previous Next
  • Salad
    Homemade Dill Salad Recipe - Healthy and Delicious Homemade Dill Salad Recipe – Healthy and Delicious
    February 8, 2026
    Healthy Wraps | Healthy Salad Recipe | High Protein Veg lettuce Wrap | Weight loss #ytshorts Healthy Wraps | Healthy Salad Recipe | High Protein Veg lettuce Wrap | Weight loss #ytshorts
    February 8, 2026
    Orange Walnut Salad | Fresh, Healthy & Flavorful Salad Recipe Orange Walnut Salad | Fresh, Healthy & Flavorful Salad Recipe
    February 8, 2026
    Russian Salad Recipe By farivlogs | Best Healthy Tasty Salad | Best For All Parties | Russian Salad Recipe By farivlogs | Best Healthy Tasty Salad | Best For All Parties |
    February 8, 2026
    Sprouts salad by acharya Manish Ji, healthy salads recipes #shorts #ytshorts #yt #trending #food Sprouts salad by acharya Manish Ji, healthy salads recipes #shorts #ytshorts #yt #trending #food
    February 8, 2026
    Previous Next
  • Bread
    Avocado toast  #recipe #food #chefrestaurant how to make easy at home Avocado toast #recipe #food #chefrestaurant how to make easy at home
    February 8, 2026
    Healthy Hare Matar Ke Kabab| Matar Kabab Recipe| #matarcutlet #ytshorts #shortsfeed Healthy Hare Matar Ke Kabab| Matar Kabab Recipe| #matarcutlet #ytshorts #shortsfeed
    February 8, 2026
    Pocket Bread: The Fastest Food Quick recipes pita bread #shorts Pocket Bread: The Fastest Food Quick recipes pita bread #shorts
    February 8, 2026
    Roti sehat bisa tetap enak #kuliner #bandung Roti sehat bisa tetap enak #kuliner #bandung
    February 8, 2026
    French toast #nashta #trending French toast #nashta #trending
    February 7, 2026
    Previous Next
  • Sandwich
    Healthy sandwich recipe #veg sandwich recipe #trending #Viralshort #food #cooking # trending music Healthy sandwich recipe #veg sandwich recipe #trending #Viralshort #food #cooking # trending music
    February 8, 2026
    Ragi Beetroot Paratha | Healthy breakfast recipe #shorts #short Ragi Beetroot Paratha | Healthy breakfast recipe #shorts #short
    February 8, 2026
    Chicken Egg Sandwich Recipe | Boiled Egg Sandwich Recipe | Sandwich Recipe | Ramzan Special Recipe Chicken Egg Sandwich Recipe | Boiled Egg Sandwich Recipe | Sandwich Recipe | Ramzan Special Recipe
    February 8, 2026
    Healthy Protein Sandwich Recipe | Easy & Healthy Iftar Snack | Ramadan Healthy Protein Sandwich Recipe | Easy & Healthy Iftar Snack | Ramadan
    February 8, 2026
    Healthy Chicken Sandwich Recipe | No Oven, High Protein, Super Easy! Healthy Chicken Sandwich Recipe | No Oven, High Protein, Super Easy!
    February 7, 2026
    Previous Next
Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |
Low Calorie

Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |

By UCOOK May 10, 2021

# blackpeppercottagecheese
#cottagecheeserecipe
#indianstyleblackpeppercottagecheese
#landofflavors

BlackblackpeppercottagecheesecheeseCottagecottagecheeserecipeCuisineFathealthyHealthy CuisineHealthy IdeasHealthy Low CalorieHealthy Low Calorie IdeasHealthy Low Calorie Recipeshealthy recipesideasIndianIndianstylecottagecheeserecipekalimirchpaneerlandofflavorslow calorieLow Calorie IdeasLow Calorie RecipeslowfatcottagecheeselowfatkalimirchpaneerpaneerrecipepepperquickrecipestyleVideoVlogwithoutcreamblackpeppercottagecheesewithoutcreamkalimirchpaneerYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.