UCOOK: Healthy Ideas
  • Recipes
    khajoor dryfruits laddu recipe/healthy dryfruit laddu #dryfruitsladdu #recipe #shortsviral #healthy khajoor dryfruits laddu recipe/healthy dryfruit laddu #dryfruitsladdu #recipe #shortsviral #healthy
    May 1, 2026
    Crispy Tuna Sushi Nachos @safecatchfoods  #safecatch #healthyrecipes #nyc Crispy Tuna Sushi Nachos @safecatchfoods #safecatch #healthyrecipes #nyc
    May 1, 2026
    Mango Saffron Ice cream! #mangodessert #easyicecreamrecipe #easyrecipe #cookingmadeeasy #healthy Mango Saffron Ice cream! #mangodessert #easyicecreamrecipe #easyrecipe #cookingmadeeasy #healthy
    May 1, 2026
    Flourless tortillas . Healthy, high-protein, and SO easy #flourless #healthyrecipes #highprotein Flourless tortillas . Healthy, high-protein, and SO easy #flourless #healthyrecipes #highprotein
    May 1, 2026
    Follow me on Instagram & Facebook @ GanjaGwyn  #highprotein #lowcarb #healthyrecipes #EasyRecipe Follow me on Instagram & Facebook @ GanjaGwyn #highprotein #lowcarb #healthyrecipes #EasyRecipe
    April 30, 2026
    Previous Next
  • Breakfast
    Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast
    May 1, 2026
    Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts  #foodie  #southindianfood Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts #foodie #southindianfood
    May 1, 2026
    Healthy breakfast recipes#shortvideo #shortsfeed #viralshorts #viralvideo #ytshorts #youtubeshorts Healthy breakfast recipes#shortvideo #shortsfeed #viralshorts #viralvideo #ytshorts #youtubeshorts
    May 1, 2026
    5 Healthy Breakfast Recipes | Easy Breakfast Ideas | Simple Breakfast Recipes Indian | Nashta 5 Healthy Breakfast Recipes | Easy Breakfast Ideas | Simple Breakfast Recipes Indian | Nashta
    May 1, 2026
    Strawberry cheesecake oats | healthy breakfast recipe Strawberry cheesecake oats | healthy breakfast recipe
    April 30, 2026
    Previous Next
  • Lunch
    Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox
    May 1, 2026
    Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts
    April 30, 2026
    healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen
    April 30, 2026
    Foods you believe are high in Protein but are not #shorts Foods you believe are high in Protein but are not #shorts
    April 30, 2026
    Banana Chocolate Cake #viralvideo #recipe #food #chocolate #cookingvlog #food #asin #shotsvideo Banana Chocolate Cake #viralvideo #recipe #food #chocolate #cookingvlog #food #asin #shotsvideo
    April 30, 2026
    Previous Next
  • Dinner
    Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy  . Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy .
    May 1, 2026
    My healthy dinner ideas / simple and easy  dinner ideas by shanulagam My healthy dinner ideas / simple and easy dinner ideas by shanulagam
    April 30, 2026
    Chicken Creamy Karahi Recipe #trending #quickrecipe Chicken Creamy Karahi Recipe #trending #quickrecipe
    April 30, 2026
    Would you try these? #healthy #recipe #cookie Would you try these? #healthy #recipe #cookie
    April 30, 2026
    Healthy Banana Cake Recipe | Eggless Banana Cake #viral @magicandmasala #recipe Healthy Banana Cake Recipe | Eggless Banana Cake #viral @magicandmasala #recipe
    April 30, 2026
    Previous Next
  • Snacks
    Easy and healthy snacks recipes follow channel friends #cookingtoday Easy and healthy snacks recipes follow channel friends #cookingtoday
    May 1, 2026
    This Snack Has Doctors Recommending It #health #nutrition #shorts This Snack Has Doctors Recommending It #health #nutrition #shorts
    April 30, 2026
    Omg this healthy snack is so tasty | With 2 Leftover Roti make this easy  Snacks Recipe | Omg this healthy snack is so tasty | With 2 Leftover Roti make this easy Snacks Recipe |
    April 30, 2026
    best kids snacks #youtube #shorts #healthysnacks#kidsfood#shortsfeed best kids snacks #youtube #shorts #healthysnacks#kidsfood#shortsfeed
    April 30, 2026
    Healthy breakfast snack with peanut butter and coconut butter with fruits Healthy breakfast snack with peanut butter and coconut butter with fruits
    April 30, 2026
    Previous Next
  • Weight Loss
    Garmi Me Best Dinner! Lauki Ka Raita | Weight Loss Recipe #lax_poo #laukiraita #shorts Garmi Me Best Dinner! Lauki Ka Raita | Weight Loss Recipe #lax_poo #laukiraita #shorts
    April 30, 2026
    Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending
    April 30, 2026
    Protein Se Bharpoor Soya Chilla | Healthy Fitness Breakfast #weightloss #shorts #nomaida Protein Se Bharpoor Soya Chilla | Healthy Fitness Breakfast #weightloss #shorts #nomaida
    April 30, 2026
    healthy and weight loss recipe#viral #recipe #cooking #trandingshorts healthy and weight loss recipe#viral #recipe #cooking #trandingshorts
    April 30, 2026
    Stop Cooking, Start Eating! (Raw Moong Salad)#Shorts #Foodie #HealthyRecipes Stop Cooking, Start Eating! (Raw Moong Salad)#Shorts #Foodie #HealthyRecipes
    April 30, 2026
    Previous Next
  • Low Calorie
    Beef Goulash Pasta High Protein Meal Prep Recipe #shorts Beef Goulash Pasta High Protein Meal Prep Recipe #shorts
    April 30, 2026
    Weight Loss Protein Rich diet #shorts#shortsfeed #food #trending #ytstudio #viral #youtubeshorts Weight Loss Protein Rich diet #shorts#shortsfeed #food #trending #ytstudio #viral #youtubeshorts
    April 30, 2026
    #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip
    April 30, 2026
    Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt! Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt!
    April 30, 2026
    April 30, 2026 April 30, 2026
    April 30, 2026
    Previous Next
  • Salad
    Crispy Cabbage Tuna Salad with Sweet Raisins | Quick & Healthy Mediterranean Recipe #healthyrecipes Crispy Cabbage Tuna Salad with Sweet Raisins | Quick & Healthy Mediterranean Recipe #healthyrecipes
    April 30, 2026
    Kohlrabi Salad That Tastes Better Than It Looks #recipe #healthysalad #summer Kohlrabi Salad That Tastes Better Than It Looks #recipe #healthysalad #summer
    April 30, 2026
    fresh and healthy salad recipe #saladrecipe #freshsalad #chickensaladrecipe fresh and healthy salad recipe #saladrecipe #freshsalad #chickensaladrecipe
    April 30, 2026
    Secret Southwestern Salad Recipe My Wife Loves (POV Dad Cooking) #cookingtime #cookingathome #meta Secret Southwestern Salad Recipe My Wife Loves (POV Dad Cooking) #cookingtime #cookingathome #meta
    April 30, 2026
    Healthy lunch salad Container. Shop my AMZ idealist: Easy-To-Go Containers Healthy lunch salad Container. Shop my AMZ idealist: Easy-To-Go Containers
    April 30, 2026
    Previous Next
  • Bread
    Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure
    April 30, 2026
    Keto Breads by Kelley Herring Review Real Tasting Keto Bread Recipe Keto Breads by Kelley Herring Review Real Tasting Keto Bread Recipe
    April 30, 2026
    bread and buiscuits dessert #food #viral #shortsfeed #shorts #tranding #short #viralvideo #trend bread and buiscuits dessert #food #viral #shortsfeed #shorts #tranding #short #viralvideo #trend
    April 30, 2026
    Diabetic-Friendly Red Lentil Bread | Weight Loss Recipe #shorts #healthy #highprotein #vegan Diabetic-Friendly Red Lentil Bread | Weight Loss Recipe #shorts #healthy #highprotein #vegan
    April 30, 2026
    Avocado Toast | kajol’s Favorite Avocado Toast Recipe #shorts Avocado Toast | kajol’s Favorite Avocado Toast Recipe #shorts
    April 30, 2026
    Previous Next
  • Sandwich
    Crispy Cheesy Corn Sandwich That's Actually Healthy #shorts #recipe #sandwich Crispy Cheesy Corn Sandwich That’s Actually Healthy #shorts #recipe #sandwich
    May 1, 2026
    Carrot Flatbread Instead of Bread! NoFlour, Air Fryer Carrot Flatbread Instead of Bread! NoFlour, Air Fryer
    April 30, 2026
    Easy Cucumber Cheese Sandwich Recipe | Quick & Healthy Snack#shorts #food Easy Cucumber Cheese Sandwich Recipe | Quick & Healthy Snack#shorts #food
    April 30, 2026
    How to Cook 100 MASSIVE Scratch Made Freezer Meals | Filling My Freezer for My Family of 10 How to Cook 100 MASSIVE Scratch Made Freezer Meals | Filling My Freezer for My Family of 10
    April 30, 2026
    Fast & Easy Chicken Parm Sandwich Fast & Easy Chicken Parm Sandwich
    April 30, 2026
    Previous Next
#shorts# Healthy instant Tiffin-Milk Bread/Breakfast for Everyone || @Petukfoodie.Priyanka
Bread

#shorts# Healthy instant Tiffin-Milk Bread/Breakfast for Everyone || @Petukfoodie.Priyanka

By UCOOK December 5, 2022

Please subscribe to my channel 🙏 @Petukfoodie.Priyanka || To watch more videos like this Subscribe to my YouTube Channel || #Petukfoodie
#shorts
#shortsvideo
#Viral

#healthybreakfastBreadBread IdeasBread RecipesbreadbreakfastCuisinehealthyHealthy BreadHealthy Bread IdeasHealthy Bread RecipesHealthy CuisineHealthy Ideashealthy recipeshealthytifinideasinstantmilkbreadPetukfoodie.PriyankarecipeshortsTiffinMilkVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.