Recipes
Make a Raw Mango Thai Salad with me! #salad #saladrecipe #weightloss #healthy #healthyrecipes
April 25, 2026
Healthy Cucumber Salad Recipe | Fresh & Refreshing Summer Salad #CucumberSalad #SummerSaladRecipe
April 25, 2026
Realistic healthy meals ! How’s your Saturday going so far? #glp1 #glp1journey #glp1meals #healthy
April 25, 2026
Healthy Sugar Free Kulfi Recipe | No Sugar Ice Cream | Easy Dry Fruit Kulfi #shorts
April 25, 2026
High Protin evening snack #viral #recipe #yt #healthyrecipes #food #diet #weightloss #cooking
April 25, 2026
Previous Next
Breakfast
Healthy Breakfast Ideas #shorts #shortvideo #viralshorts #fruits #healthy
April 26, 2026
These 6 Foods Should Be in Your Breakfast | Healthy Breakfast Ideas
April 25, 2026
Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts
April 25, 2026
Vermicelli Upma # Healthy Breakfast Recipe #ExplorerApoorvaFoodVlogs.
April 25, 2026
Instant Recipe | Healthy Breakfast Idea #healthybreakfast #instantrecipe
April 25, 2026
Previous Next
Lunch
#cookwithniku #trending #mangojamrecipe #jamrecipe #food #healthy #viral #viralshorts #shorts #mango
April 25, 2026
Best Breakfast For Diabetics – Barley Porridge!#barley #breakfast #food #recipe #shorts #shortsfeed
April 25, 2026
Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas #food #husband #healthy
April 25, 2026
#mangofishcurry # #lunchideas #healthy lunch for summer #.
April 25, 2026
healthy lunch box @kesar-vlog
April 25, 2026
Previous Next
Dinner
Chick Fil A Breakfast Casserole Meal Prep #shorts
April 25, 2026
healthy dinner recipe #treanding #viral #cooking #food #dinner #recipe #anitadevshalibhatt
April 25, 2026
Gluten Free Healthy Chilla Recipe #myjainrecipe
April 25, 2026
Singdana vali simla mirchi ki sabji | #shortsfeed
April 25, 2026
Quick Soya Pulao Recipe | Healthy & Tasty | #pulao #quickrecipe
April 25, 2026
Previous Next
Snacks
“Kids Tiffin Snack | Suji Matar Recipe | 5-Min Healthy Snack”
April 26, 2026
murmura ka healthy evening snacks #food #recipe #viral #shorts
April 25, 2026
Evening Snacks Recipe | Easy And Quick Recipe #shorts #youtubeshorts #trending #snacks
April 25, 2026
#khudihandisala #coldcoffee #food #snacks #recipe #cooking #drinks #shortvideo #shortsfeed
April 25, 2026
Healthy n quick recipe #cornchat #chat #makairecipe #bhel #viral #ytshorts #foodie #cooking#trending
April 25, 2026
Previous Next
Weight Loss
High Protein Paneer Sandwich | Easy Healthy Recipe | Weight Loss Friendly#shorts #paneersandwich
April 25, 2026
Roasted Chana Chaat Recipe #shorts #shortsfeed #food #chaat #amaarrannabynikunja #chaatrecipe
April 25, 2026
Tasty Soyabean Chunks ka nashta #youtubeshorts #recipe #feed #healthysnacks
April 25, 2026
Easy and healthy weight loss drink | babyskitchen #shorts
April 25, 2026
Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe
April 25, 2026
Previous Next
Low Calorie
This entire breakfast was only 370 cals and 52g of protein! #lowcalorie #highprotein #mealideas
April 25, 2026
Protein blanket dumplings with 38g protein #ytshorts #recipe
April 25, 2026
Dr Manishaa’s Secrets For Naturally Glowing & Shiny Skin! #easyrecipe #glowingskin
April 25, 2026
Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak
April 25, 2026
kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe
April 25, 2026
Previous Next
Salad
Droolworthy yet guiltfree | Classic Chicken Salad | Homemade Salad Recipe
April 25, 2026
Skip heavy meals this summer & make this wholesome & refreshing salad! #salad #viral #food #recipe
April 25, 2026
Healthy Weight Loss Salad Recipe | Healthy Weight Loss Recipe | Healthy Easy Salad Recipe
April 25, 2026
Healthy Salad Recipe | Chana Lobia Salad Recipe | Weight Loss Recipe |
April 25, 2026
Strawberry Banana Salad Recipe | Healthy Salad Recipes | Creamy Fruit Salad | Salad Recipe
April 25, 2026
Previous Next
Bread
Ghr pe pe bread ho to jhatpat se bnao ye breakfast.suji bread#youtubeshorts#recipe@nehaguptavlog246
April 26, 2026
Healthy Breakfast Banana Muffins #shorts #muffins #recipe #bananabread
April 25, 2026
Stop Eating Bread! Try This High Protein Healthy Breakfast | Lunch Box | Tiffin Recipes | Breakfast
April 25, 2026
easy tasty healthy mithaai recipe#bread sweets dessert#recipe#health#food
April 25, 2026
healthy bread roll recipe #bread roll #ytshorts
April 25, 2026
Previous Next
Sandwich
Triple C Sandwich Recipe | Creamy Veg Sandwich | No Cook Easy Sandwich Recipe
April 25, 2026
5 Super detox combo juice #nls #naturallifestyle #healthyfood #curedetox #food #facts
April 25, 2026
Healthy sandwich for breakfast || deep food recipes #like #recipe #food #healthysandwich #breakfast
April 25, 2026
Healthy 5 Min Easy Brown Bread Paneer Sandwich Breakfast Recipe #shorts #breakfast #sandwich
April 25, 2026
celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts
April 25, 2026
Previous Next

rice murmure bhel#worldofcookoffcial#eveningsnacks#recipe#easyrecipe#shortsfeed#healthy#

rice murmure bhel#worldofcookoffcial#eveningsnacks#recipe#easyrecipe#shortsfeed#healthy#

By UCOOK September 10, 2025

bhelworldofcookoffcialeveningsnacksrecipeeasyrecipeshortsfeedhealthy Cuisine healthy Healthy Cuisine Healthy Ideas healthy recipes healthy snacks Healthy Snacks Ideas Healthy Snacks Recipes ideas Murmure recipe rice snacks Snacks Ideas Video Vlog YouTube

Type above and press Enter to search. Press Esc to cancel.