UCOOK: Healthy Ideas
  • Recipes
    Kovakkai Poriyal | Tasty & Healthy recipes  #auslinhealthybites Kovakkai Poriyal | Tasty & Healthy recipes #auslinhealthybites
    April 29, 2026
    Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer
    April 29, 2026
    3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy 3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy
    April 29, 2026
    #mealprep #healthyeating #healthyrecipes #healthyhabits #mealprep #healthyeating #healthyrecipes #healthyhabits
    April 29, 2026
    Biotin Laddu || Protein Laddu #shorts #youtubeshorts   #shortvideo #recipe #ytshorts #yt #healthy Biotin Laddu || Protein Laddu #shorts #youtubeshorts #shortvideo #recipe #ytshorts #yt #healthy
    April 29, 2026
    Previous Next
  • Breakfast
    Sweet Corn Poha! Kids favourite sweet corn poha recipe! healthy breakfast recipe #sweetcornpoha Sweet Corn Poha! Kids favourite sweet corn poha recipe! healthy breakfast recipe #sweetcornpoha
    April 29, 2026
    sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo
    April 29, 2026
    healthy breakfast recipe #shorts #shortsfeed #youtubeshorts #food #healthyfood #health healthy breakfast recipe #shorts #shortsfeed #youtubeshorts #food #healthyfood #health
    April 29, 2026
    Besan Ka Chilla Recipe | Healthy Breakfast in 10 Minutes#ytshorts #trending #shorts Besan Ka Chilla Recipe | Healthy Breakfast in 10 Minutes#ytshorts #trending #shorts
    April 29, 2026
    5 minute m banaya poha | easy breakfast recipe | 5 minute m banaya poha | easy breakfast recipe |
    April 29, 2026
    Previous Next
  • Lunch
    High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner's Recipe | Easy Hostel Recipes High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner’s Recipe | Easy Hostel Recipes
    April 29, 2026
    Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania
    April 29, 2026
    Quick Rajgira Paratha Recipe #food #toddlerfood #toddlerapproved Quick Rajgira Paratha Recipe #food #toddlerfood #toddlerapproved
    April 29, 2026
    Dal chawal benefits by Vedant sir#shorts #food #cooking #dalchawal #thali #lunch #healthy #viral Dal chawal benefits by Vedant sir#shorts #food #cooking #dalchawal #thali #lunch #healthy #viral
    April 29, 2026
    Kheera raita was made to escape the heat #shorts #heat #kheer #viral #food #recipe #cooking Kheera raita was made to escape the heat #shorts #heat #kheer #viral #food #recipe #cooking
    April 29, 2026
    Previous Next
  • Dinner
    Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes
    April 29, 2026
    #corn in #airfryer #philips #recipe #ytshorts #food #foodie #shorts #healthy #yummy #corn in #airfryer #philips #recipe #ytshorts #food #foodie #shorts #healthy #yummy
    April 29, 2026
    Drumstick Leaves Soup | Healthy Detox Soup Recipe Moringa soup #unique cooking # morning #recipe Drumstick Leaves Soup | Healthy Detox Soup Recipe Moringa soup #unique cooking # morning #recipe
    April 29, 2026
    Healthy Dinner Idea! High Protein Chicken Potato Bake! Comfort Meal Prep! Healthy Dinner Idea! High Protein Chicken Potato Bake! Comfort Meal Prep!
    April 29, 2026
    Flax seeds vadi #nutrition #healthy #homemade #food #recipe #summer #vacation #viral#trending#shorts Flax seeds vadi #nutrition #healthy #homemade #food #recipe #summer #vacation #viral#trending#shorts
    April 29, 2026
    Previous Next
  • Snacks
    Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice
    April 29, 2026
    today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral
    April 29, 2026
    Sugar Free Sweets / sewai | Healthy Ramadan Iftar Sweet | Healthy Sweets | Healthy Sewairecipe Sugar Free Sweets / sewai | Healthy Ramadan Iftar Sweet | Healthy Sweets | Healthy Sewairecipe
    April 29, 2026
    Crispy Karela Chips | Healthy Snacks Crispy Karela Chips | Healthy Snacks
    April 29, 2026
    Bihar Makhana Snacks Recipe | Healthy Fox Nut Snack at Home #shorts #eveningsnacks #biharmakhana Bihar Makhana Snacks Recipe | Healthy Fox Nut Snack at Home #shorts #eveningsnacks #biharmakhana
    April 29, 2026
    Previous Next
  • Weight Loss
    Cucumber kimchi salad recipe |weight-loss recipe| Cucumber kimchi salad recipe |weight-loss recipe|
    April 29, 2026
    WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule
    April 29, 2026
    Low Calorie Carrot Noodles Salad | Healthy Weight Loss Recipe | Summer Salads | Easy Carrot Salad Low Calorie Carrot Noodles Salad | Healthy Weight Loss Recipe | Summer Salads | Easy Carrot Salad
    April 29, 2026
    healthy chana chaat #food #health #weightloss #shorts #youtubeshorts #cooking #ytshorts healthy chana chaat #food #health #weightloss #shorts #youtubeshorts #cooking #ytshorts
    April 29, 2026
    Stop Eating Regular Dosa Try This Healthy High Protein Dosa #shorts #youtubeshorts #weightloss #dosa Stop Eating Regular Dosa Try This Healthy High Protein Dosa #shorts #youtubeshorts #weightloss #dosa
    April 29, 2026
    Previous Next
  • Low Calorie
    Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes
    April 29, 2026
    5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet 5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet
    April 29, 2026
    #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss
    April 29, 2026
    “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food
    April 29, 2026
    Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food
    April 29, 2026
    Previous Next
  • Salad
    healthy morning breakfast #salad #breakfast #snacks #sprouts #homemadefood #viralcookingshorts #yt healthy morning breakfast #salad #breakfast #snacks #sprouts #homemadefood #viralcookingshorts #yt
    April 29, 2026
    Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts
    April 29, 2026
    5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad 5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad
    April 29, 2026
    Cucumber and carrot healthy salad. #handmadefood #recipe #easyrecipe #viral #shorts Cucumber and carrot healthy salad. #handmadefood #recipe #easyrecipe #viral #shorts
    April 29, 2026
    Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees | Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees |
    April 29, 2026
    Previous Next
  • Bread
    Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts
    April 29, 2026
    bread cutlet recipe#trending #food #healthy#snacksshorts bread cutlet recipe#trending #food #healthy#snacksshorts
    April 29, 2026
    Bread Gets A Glow Up With This Hack #cooking #foodhacks #recipe Bread Gets A Glow Up With This Hack #cooking #foodhacks #recipe
    April 29, 2026
    Bread flower pizza |easy tasty recipes #foodie #shorts #healthy Bread flower pizza |easy tasty recipes #foodie #shorts #healthy
    April 29, 2026
    Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box
    April 29, 2026
    Previous Next
  • Sandwich
    Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs
    April 29, 2026
    No Sauce No Mayonnaise | Pure Ghar Ki Healthy Veg Sandwich Recipe | Easy Tasty Breakfast No Sauce No Mayonnaise | Pure Ghar Ki Healthy Veg Sandwich Recipe | Easy Tasty Breakfast
    April 29, 2026
    Ankurit Sandwich Healthy Bhi Tasty Bhi  #sandwich #streetfood #jaipurfood #shorts #viral #trending Ankurit Sandwich Healthy Bhi Tasty Bhi #sandwich #streetfood #jaipurfood #shorts #viral #trending
    April 29, 2026
    Super Tasty Breakfast Ready #viral #food #trending #recipe #youtubeshorts #easyrecipe #sandwich Super Tasty Breakfast Ready #viral #food #trending #recipe #youtubeshorts #easyrecipe #sandwich
    April 29, 2026
    Instant Morning Breakfast Recipes | Tiffin Recipes | Healthy Kids Lunchbox | Easy Breakfast Recipe Instant Morning Breakfast Recipes | Tiffin Recipes | Healthy Kids Lunchbox | Easy Breakfast Recipe
    April 29, 2026
    Previous Next
Minivlog 34  Healthy dinner routine #healthylifestyle #vegetablekuruma #chapati #dinnerideas #dinner
Dinner

Minivlog 34 Healthy dinner routine #healthylifestyle #vegetablekuruma #chapati #dinnerideas #dinner

By UCOOK December 15, 2025



For quaries : sathyavinsamayal@gmail.com

follow me on

Instagram : https://www.instagram.com/sathyapani/…

facebook : https://www.facebook.com/sathyapani

Thank u…

chapatiCuisinedinnerdinner ideasdinnerideashealthyHealthy Cuisinehealthy dinnerhealthy dinner ideasHealthy dinner recipesHealthy Ideashealthy recipeshealthylifestyleideasminivlogreciperoutinevegetablekurumaVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.