UCOOK: Healthy Ideas
  • Recipes
    soyabean Crispy & Healthy snack| Crispy snack | Snacks recipe #recipe #snackrecipe #healthy soyabean Crispy & Healthy snack| Crispy snack | Snacks recipe #recipe #snackrecipe #healthy
    February 10, 2026
    Gajar ki kheer #ytshorts #kheer #shivratrispecial #carrotkheer #healthyrecipes Gajar ki kheer #ytshorts #kheer #shivratrispecial #carrotkheer #healthyrecipes
    February 10, 2026
    Sevai upma recipe #shorts #upma #healthy #viral #trending #shortsfeed #cooking Sevai upma recipe #shorts #upma #healthy #viral #trending #shortsfeed #cooking
    February 10, 2026
    Quick Lunch Box Recipe | Healthy Recipes | #lunch #lunchbox #vegetarian #healthy #lunchboxideas Quick Lunch Box Recipe | Healthy Recipes | #lunch #lunchbox #vegetarian #healthy #lunchboxideas
    February 10, 2026
    Rudra ka Super healthy recipes || #newmom #familychannel #baby #vlog Rudra ka Super healthy recipes || #newmom #familychannel #baby #vlog
    February 10, 2026
    Previous Next
  • Breakfast
    Healthy Breakfast Recipe #shorts #ytshort #healthybreakfast #homefoodtreasure Healthy Breakfast Recipe #shorts #ytshort #healthybreakfast #homefoodtreasure
    February 10, 2026
    special healthy breakfast recipe #food #breakfastfoods #cookingshorts special healthy breakfast recipe #food #breakfastfoods #cookingshorts
    February 10, 2026
    Healthy breakfast ideas | instant recipe| suji chilla #shortvideos #youtubeshorts #viral Healthy breakfast ideas | instant recipe| suji chilla #shortvideos #youtubeshorts #viral
    February 10, 2026
    Instant Healthy Breakfast Only 2 min /Instant Healthy Breakfast Recipes Indian/Tiffin Recipes/Tiffin Instant Healthy Breakfast Only 2 min /Instant Healthy Breakfast Recipes Indian/Tiffin Recipes/Tiffin
    February 10, 2026
    The Best Healthy Breakfast Ideas (That Actually Taste Good!) The Best Healthy Breakfast Ideas (That Actually Taste Good!)
    February 10, 2026
    Previous Next
  • Lunch
    Only 5 Minutes! Spicy Garlic Egg Rice Recipe. #shorts #food #cooking #eggrice #viral #trending #fyp Only 5 Minutes! Spicy Garlic Egg Rice Recipe. #shorts #food #cooking #eggrice #viral #trending #fyp
    February 10, 2026
    lunch box recipes|kothimeera rice|coriander rice|lunch box#shorts#viral#food#cooking#youtubeshorts lunch box recipes|kothimeera rice|coriander rice|lunch box#shorts#viral#food#cooking#youtubeshorts
    February 10, 2026
    Easy Lunch Box Recipe | How To Make Tasty Hotel Mix Recipe | Healthy lunch Recipe Easy Lunch Box Recipe | How To Make Tasty Hotel Mix Recipe | Healthy lunch Recipe
    February 10, 2026
    #Today's samayal millets dosai and pavakkai fry #shortsfeed #recipe #cooking #youtubevideo #lunch #Today’s samayal millets dosai and pavakkai fry #shortsfeed #recipe #cooking #youtubevideo #lunch
    February 10, 2026
    Healthy Lunch Thali #indianfood #lunchideas #shorts #viral Healthy Lunch Thali #indianfood #lunchideas #shorts #viral
    February 10, 2026
    Previous Next
  • Dinner
    Easy healthy dinner #cleaneating  #consciouseating #food #healthyfood Easy healthy dinner #cleaneating #consciouseating #food #healthyfood
    February 10, 2026
    Veg biryani #healthy #lunch #lunchbox #recipe #food #shortsfeed #indianfood #shorts #biryani #viral Veg biryani #healthy #lunch #lunchbox #recipe #food #shortsfeed #indianfood #shorts #biryani #viral
    February 10, 2026
    Quick Chicken Recipes with Onion | Easy + Healthy Dinner Quick Chicken Recipes with Onion | Easy + Healthy Dinner
    February 10, 2026
    healthy cheeps #food #recipe #cooking #lifestyle #vlog #shorts healthy cheeps #food #recipe #cooking #lifestyle #vlog #shorts
    February 10, 2026
    benefits of milk and nutmeg#health#recipe#food#jayfal#shorts benefits of milk and nutmeg#health#recipe#food#jayfal#shorts
    February 10, 2026
    Previous Next
  • Snacks
    Easy & healthy snack idea!!! Easy & healthy snack idea!!!
    February 11, 2026
    7 Simple Easy & Healthy Snacks recipes with easy tips and tricks by aapki kitchen with Neeru Walia 7 Simple Easy & Healthy Snacks recipes with easy tips and tricks by aapki kitchen with Neeru Walia
    February 10, 2026
    Healthy and tasty|Bihari thekua recipe|snacks recipe |Shorts |Viral Healthy and tasty|Bihari thekua recipe|snacks recipe |Shorts |Viral
    February 10, 2026
    Hare matar se bana soft & healthy dhokla #dhokla #viralvideo #trendingnow #recipe #shortsfeed Hare matar se bana soft & healthy dhokla #dhokla #viralvideo #trendingnow #recipe #shortsfeed
    February 10, 2026
    Healthy Snacks / Makhana Recipe #youtubeshorts #makhana #healthyfood #snacks #shorts Healthy Snacks / Makhana Recipe #youtubeshorts #makhana #healthyfood #snacks #shorts
    February 10, 2026
    Previous Next
  • Weight Loss
    Moong Dal Chilla Recipe |Healthy High Protein Cheela for weightloss #viral #shorts #recipe #youtube Moong Dal Chilla Recipe |Healthy High Protein Cheela for weightloss #viral #shorts #recipe #youtube
    February 10, 2026
    Oats Dosa Recipe|| Weightloss Dosa #oatsrecipe #oatsdosa Oats Dosa Recipe|| Weightloss Dosa #oatsrecipe #oatsdosa
    February 10, 2026
    Bajra Palak Chilla Recipe | Healthy Weight Loss Breakfast | High Protein Chilla #BajraRecipe# Bajra Palak Chilla Recipe | Healthy Weight Loss Breakfast | High Protein Chilla #BajraRecipe#
    February 10, 2026
    Strawberry Chia Pudding | Lose Weight Fast With these Weight Loss Dessert #shorts #chiapudding Strawberry Chia Pudding | Lose Weight Fast With these Weight Loss Dessert #shorts #chiapudding
    February 10, 2026
    10 Minutes High Protein Veg Breakfast Recipes | Tiffin Recipes | Kids Lunchbox Recipes | Weightloss 10 Minutes High Protein Veg Breakfast Recipes | Tiffin Recipes | Kids Lunchbox Recipes | Weightloss
    February 10, 2026
    Previous Next
  • Low Calorie
    Patra/AluVadi Healthy, Nutritious & low-calorie snack#youtubeshorts #shorts #ytshorts #trending # Patra/AluVadi Healthy, Nutritious & low-calorie snack#youtubeshorts #shorts #ytshorts #trending #
    February 10, 2026
    I Crossed the Line With These Low-Cal High-Protein Momos #shorts #momo #healthysnacks I Crossed the Line With These Low-Cal High-Protein Momos #shorts #momo #healthysnacks
    February 10, 2026
    Low calorie makhana salad recipe for weight loss Low calorie makhana salad recipe for weight loss
    February 10, 2026
    I Eat This Chocolate Mousse While Losing Fat I Eat This Chocolate Mousse While Losing Fat
    February 10, 2026
    Hearty Homemade Vegetable Soup| Healthy Soup For Winter | Low Calorie Soup Hearty Homemade Vegetable Soup| Healthy Soup For Winter | Low Calorie Soup
    February 10, 2026
    Previous Next
  • Salad
    Banana Milkshake || Healthy Drink || #salad #food #viralvideo #helthyfood Banana Milkshake || Healthy Drink || #salad #food #viralvideo #helthyfood
    February 10, 2026
    Diabetes Friendly Bean Salad Recipe | Healthy & Tasty Diabetes Friendly Bean Salad Recipe | Healthy & Tasty
    February 10, 2026
    Healthy salad recipe #told Subhash Goyal ji #healthy recipe #Women #short #viral #healthy life style Healthy salad recipe #told Subhash Goyal ji #healthy recipe #Women #short #viral #healthy life style
    February 10, 2026
    Super food salad/sauted veggies #shorts Super food salad/sauted veggies #shorts
    February 10, 2026
    Quinoa Salad| Salad Recipe for weightloss| Healthy Salad Recipes #salad #shortsviral #viral #healthy Quinoa Salad| Salad Recipe for weightloss| Healthy Salad Recipes #salad #shortsviral #viral #healthy
    February 10, 2026
    Previous Next
  • Bread
    crispy Bread omelette healthy &Testy #breadomelette #viral #recipe #cooking #foodie crispy Bread omelette healthy &Testy #breadomelette #viral #recipe #cooking #foodie
    February 10, 2026
    Veg Grilled Sandwich | Easy Bread Recipe | Crispy & Tasty#ytshorts #breadrecipe #vegsandwich#short Veg Grilled Sandwich | Easy Bread Recipe | Crispy & Tasty#ytshorts #breadrecipe #vegsandwich#short
    February 10, 2026
    ROTI FULANE KA SEHI TARIKA #roti #chapati #ytshorts #rotitips #indianfood #flatbread #healthy ROTI FULANE KA SEHI TARIKA #roti #chapati #ytshorts #rotitips #indianfood #flatbread #healthy
    February 10, 2026
    Let's make some quick and flavorful MASALA FRENCH TOAST| Indian style Savory French Toast| #toast Let’s make some quick and flavorful MASALA FRENCH TOAST| Indian style Savory French Toast| #toast
    February 10, 2026
    Who Knew Ragi Roti Could Be This Soft? Must-Try Hack! #shortsfeed #ragi #roti #recipe #viral #yts Who Knew Ragi Roti Could Be This Soft? Must-Try Hack! #shortsfeed #ragi #roti #recipe #viral #yts
    February 10, 2026
    Previous Next
  • Sandwich
    Avacado sandwich recipe...#shorts #shortvideo #shortsfeed #cooking #recipe #food #trending #viral Avacado sandwich recipe…#shorts #shortvideo #shortsfeed #cooking #recipe #food #trending #viral
    February 10, 2026
    Suji aloo ki New recipe | bina bread ki sandwich #youtubeshorts #shorts #shortsvideo #sandwich Suji aloo ki New recipe | bina bread ki sandwich #youtubeshorts #shorts #shortsvideo #sandwich
    February 10, 2026
    Crispy Tost Chicken Sandwich Recipe#chikensandwich#sandwichrecipe#desifood#pakistanifood#cooking Crispy Tost Chicken Sandwich Recipe#chikensandwich#sandwichrecipe#desifood#pakistanifood#cooking
    February 10, 2026
    Healthy Sandwich|Rachel#youtube#food#cooking#healthy#recipe#new#instagram#home#dailyvlog#shortfeed Healthy Sandwich|Rachel#youtube#food#cooking#healthy#recipe#new#instagram#home#dailyvlog#shortfeed
    February 10, 2026
    Quick & Easy 5 Minutes Mayonnaise Sandwich Veg Mayo Sandwich | #shorts #vegsandwich Quick & Easy 5 Minutes Mayonnaise Sandwich Veg Mayo Sandwich | #shorts #vegsandwich
    February 10, 2026
    Previous Next
Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |
Low Calorie

Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |

By UCOOK May 10, 2021

# blackpeppercottagecheese
#cottagecheeserecipe
#indianstyleblackpeppercottagecheese
#landofflavors

BlackblackpeppercottagecheesecheeseCottagecottagecheeserecipeCuisineFathealthyHealthy CuisineHealthy IdeasHealthy Low CalorieHealthy Low Calorie IdeasHealthy Low Calorie Recipeshealthy recipesideasIndianIndianstylecottagecheeserecipekalimirchpaneerlandofflavorslow calorieLow Calorie IdeasLow Calorie RecipeslowfatcottagecheeselowfatkalimirchpaneerpaneerrecipepepperquickrecipestyleVideoVlogwithoutcreamblackpeppercottagecheesewithoutcreamkalimirchpaneerYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.