UCOOK: Healthy Ideas
  • Recipes
    #Dal pitha #Bihari Dish #@Quick Recipes with Priyanka #dalpitha #healthyrecipes #biharifood # #Dal pitha #Bihari Dish #@Quick Recipes with Priyanka #dalpitha #healthyrecipes #biharifood #
    April 26, 2026
    Vaidya Rajesh Kapoor's Refreshing Beal Ka Sharbat Recipe! #shorts #easyrecipe Vaidya Rajesh Kapoor’s Refreshing Beal Ka Sharbat Recipe! #shorts #easyrecipe
    April 26, 2026
    Banana Milkshake #milkshake #bananashake #healthy #healthydrink #recipe #cooking #viral #ytshorts Banana Milkshake #milkshake #bananashake #healthy #healthydrink #recipe #cooking #viral #ytshorts
    April 26, 2026
    #breakfast #healthy #recipe #zerooilsnacks #food #morning #explore #shorts #trending #instagram #breakfast #healthy #recipe #zerooilsnacks #food #morning #explore #shorts #trending #instagram
    April 26, 2026
    Follow my channel to get easy and healthy recipes #momos #recipe #homemade@lazycookingwithme Follow my channel to get easy and healthy recipes #momos #recipe #homemade@lazycookingwithme
    April 26, 2026
    Previous Next
  • Breakfast
    Simple breakfast plate | Healthy breakfast ideas #foodshorts #breakfast Simple breakfast plate | Healthy breakfast ideas #foodshorts #breakfast
    April 26, 2026
    Healthy Breakfast Ideas: Delicious Vegetable Semiya Upma in 10 Minutes. Healthy Breakfast Ideas: Delicious Vegetable Semiya Upma in 10 Minutes.
    April 26, 2026
    Instant Premix  Upma in Minutes  | Quick & Healthy Breakfast Recipe | #upma #ytshorts #foodie Instant Premix Upma in Minutes | Quick & Healthy Breakfast Recipe | #upma #ytshorts #foodie
    April 26, 2026
    Goan Rice Flour Onions Bhakri | Healthy Breakfast Recipe | #goanrecipe #fernscooking Goan Rice Flour Onions Bhakri | Healthy Breakfast Recipe | #goanrecipe #fernscooking
    April 26, 2026
    Instant Healthy Breakfast Recipes Indian/Easy Breakfast Recipe/Nasta Recipe/Suji Ka Nasta Instant Healthy Breakfast Recipes Indian/Easy Breakfast Recipe/Nasta Recipe/Suji Ka Nasta
    April 26, 2026
    Previous Next
  • Lunch
    Aaj ke Lunch me ye banaya tha #shorts #shortsfeed #trendingshorts #viralvideo #bristihomekitchen Aaj ke Lunch me ye banaya tha #shorts #shortsfeed #trendingshorts #viralvideo #bristihomekitchen
    April 27, 2026
    No Fat Healthy Lunch Idea!! #lunch #shortsfeed #shortsvideo #ideas #lunchideas No Fat Healthy Lunch Idea!! #lunch #shortsfeed #shortsvideo #ideas #lunchideas
    April 26, 2026
    Simple Healthy Lunch Idea #shorts #youtubeshorts #healthyeating #healthylunch #lunchideas Simple Healthy Lunch Idea #shorts #youtubeshorts #healthyeating #healthylunch #lunchideas
    April 26, 2026
    Easy Healthy Breakfast Idea | Cucumber Carrot Noodles #healthy #easyrecipe Easy Healthy Breakfast Idea | Cucumber Carrot Noodles #healthy #easyrecipe
    April 26, 2026
    Hotel Style Sambhar Recipe #shorts #shortsfeed #viral #trending #sambhar #youtubeshorts Hotel Style Sambhar Recipe #shorts #shortsfeed #viral #trending #sambhar #youtubeshorts
    April 26, 2026
    Previous Next
  • Dinner
    Iron-rich, gut-friendly ragi idlis for lunch today #youtube #healthy #lunch #recipe #cooking #shorts Iron-rich, gut-friendly ragi idlis for lunch today #youtube #healthy #lunch #recipe #cooking #shorts
    April 27, 2026
    Juicy Salmon in 10 Minutes | Easy Healthy Dinner Juicy Salmon in 10 Minutes | Easy Healthy Dinner
    April 26, 2026
    Authentic Vegetable Sambar Recipe | South Indian Style Sambar | Easy & Healthy Dinner Recipe#food Authentic Vegetable Sambar Recipe | South Indian Style Sambar | Easy & Healthy Dinner Recipe#food
    April 26, 2026
    Healthy Snickers Bites | 3 Ingredients | Healthy Desserts #recipe #shortsvideo #chocolate #snickers Healthy Snickers Bites | 3 Ingredients | Healthy Desserts #recipe #shortsvideo #chocolate #snickers
    April 26, 2026
    healthy dinner idea #healthydinner #healthydinnerideas #easymealideas  #healthymeals #salmondinner healthy dinner idea #healthydinner #healthydinnerideas #easymealideas #healthymeals #salmondinner
    April 26, 2026
    Previous Next
  • Snacks
    Tiffin Recipe | Lunchbox |Nashta Recipe| Breakfast| Snacks #shorts #easyrecipe #tiffin #snacks #food Tiffin Recipe | Lunchbox |Nashta Recipe| Breakfast| Snacks #shorts #easyrecipe #tiffin #snacks #food
    April 27, 2026
    Dark chocolate Chia seeds pudding. Healthy snack recipes #food #shorts Dark chocolate Chia seeds pudding. Healthy snack recipes #food #shorts
    April 26, 2026
    5 Easy Healthy Snacks Recipes for Kids | Lunchbox Ideas (No Refined Sugar) 5 Easy Healthy Snacks Recipes for Kids | Lunchbox Ideas (No Refined Sugar)
    April 26, 2026
    Ek Baar Ye Healthy Tisauri(flaxseed) Chips Bana Liye to Market Chips Bhool Jaoge  #youtubeshorts Ek Baar Ye Healthy Tisauri(flaxseed) Chips Bana Liye to Market Chips Bhool Jaoge #youtubeshorts
    April 26, 2026
    Chana dal chat#ViralRecipe #streetfoodstyle #food#cooking #indianrecipe #recipe #shorts #ytshorts Chana dal chat#ViralRecipe #streetfoodstyle #food#cooking #indianrecipe #recipe #shorts #ytshorts
    April 26, 2026
    Previous Next
  • Weight Loss
    Chia Seeds Pudding #healthy #dessert #weightloss #chiaseeds #shorts Chia Seeds Pudding #healthy #dessert #weightloss #chiaseeds #shorts
    April 26, 2026
    " I Tried this Viral Summer Drink Receipe - Shocking Results " #shorts #trending #weightloss ” I Tried this Viral Summer Drink Receipe – Shocking Results ” #shorts #trending #weightloss
    April 26, 2026
    No Oil Paneer Fried Rice | High Protein Low Fat Meal | 5 Min Quick & Easy Weight Loss Recipe No Oil Paneer Fried Rice | High Protein Low Fat Meal | 5 Min Quick & Easy Weight Loss Recipe
    April 26, 2026
    Healthy breakfast for weightloss by Acharya Manish ji #shorts #healthy #ayurved #ytshorts #chana Healthy breakfast for weightloss by Acharya Manish ji #shorts #healthy #ayurved #ytshorts #chana
    April 26, 2026
    No Sugar Mango Custard | Healthy Dessert #shorts #viral #shortsfeed #weightloss #easyrecipe No Sugar Mango Custard | Healthy Dessert #shorts #viral #shortsfeed #weightloss #easyrecipe
    April 26, 2026
    Previous Next
  • Low Calorie
    Let me know if you guys want more easy low calorie recipes!... #Shorts #paytonmey Let me know if you guys want more easy low calorie recipes!… #Shorts #paytonmey
    April 26, 2026
    Sweet CRAVINGS, but STAYING ON TRACK? Only 4 INGREDIENTS, Low Calorie, High Protein & Delicious Sweet CRAVINGS, but STAYING ON TRACK? Only 4 INGREDIENTS, Low Calorie, High Protein & Delicious
    April 26, 2026
    Tera sath hai kitna pyara #viral #food #recipe #fruit #facts #easyrecipe #shortfeed #food Tera sath hai kitna pyara #viral #food #recipe #fruit #facts #easyrecipe #shortfeed #food
    April 26, 2026
    Healthy Chilla #ytshorts #ytviral #healthyrecipes #cooking #healthychilla #healthybreakfast #receipe Healthy Chilla #ytshorts #ytviral #healthyrecipes #cooking #healthychilla #healthybreakfast #receipe
    April 26, 2026
    “Better Than Fried,"Healthy Manchurian Hack ,Easy  #shortvideo #food #cooking #recipe #shortsfeed “Better Than Fried,”Healthy Manchurian Hack ,Easy #shortvideo #food #cooking #recipe #shortsfeed
    April 26, 2026
    Previous Next
  • Salad
    Is pasta salad healthy?!? Is pasta salad healthy?!?
    April 26, 2026
    Healthy Vegetable Mix Salad Recipe.#recipe #food #shorts Healthy Vegetable Mix Salad Recipe.#recipe #food #shorts
    April 26, 2026
    Healthy Chatpata Noodles Salad Recipe #noodlesalad #salad #quickrecipe #easyrecipes #healthysnacks Healthy Chatpata Noodles Salad Recipe #noodlesalad #salad #quickrecipe #easyrecipes #healthysnacks
    April 26, 2026
    Healthy Layered Salad Meal Prep | Weekly Fresh Veggie Salad Recipe | F For FLavor Healthy Layered Salad Meal Prep | Weekly Fresh Veggie Salad Recipe | F For FLavor
    April 26, 2026
    Cucumber Kimchi Salad Recipe #food #shots #asmr #healthy #kimchi #cucumbersalad #recipe #easy Cucumber Kimchi Salad Recipe #food #shots #asmr #healthy #kimchi #cucumbersalad #recipe #easy
    April 26, 2026
    Previous Next
  • Bread
    Raghav Chadha healthy almond mango shake recipe #shorts #viral #trending #raghavchadha #mangoshake Raghav Chadha healthy almond mango shake recipe #shorts #viral #trending #raghavchadha #mangoshake
    April 27, 2026
    IDLI PODI  | #healthy | #shorts |#minivlog  |#vlog |#shortsfeed |#short |#shortsvideo IDLI PODI | #healthy | #shorts |#minivlog |#vlog |#shortsfeed |#short |#shortsvideo
    April 27, 2026
    Healthy Whole Wheat Baladi Bread Recipe |  Soft Egyptian Baladi Bread in my own version Healthy Whole Wheat Baladi Bread Recipe | Soft Egyptian Baladi Bread in my own version
    April 26, 2026
    Healthy Veg Nuggets Recipe (No Fry) | Kids Tiffin Recipe | Toddler Meals | Easy Healthy Snack Idea Healthy Veg Nuggets Recipe (No Fry) | Kids Tiffin Recipe | Toddler Meals | Easy Healthy Snack Idea
    April 26, 2026
    Suji Se bana nasta #cooking #food #healthy #recipe #youtube #explore Suji Se bana nasta #cooking #food #healthy #recipe #youtube #explore
    April 26, 2026
    Previous Next
  • Sandwich
    Toast Recipe | Lunch Box Egg Toast Recipe | Healthy Bread Toast Recipe | Cheesy Bread Toast Recipe | Toast Recipe | Lunch Box Egg Toast Recipe | Healthy Bread Toast Recipe | Cheesy Bread Toast Recipe |
    April 27, 2026
    Healthy Cucumber Cold Sendwich Recipe #Sendwich #cucumbersendwich #shortsvideo #reels #recipe Healthy Cucumber Cold Sendwich Recipe #Sendwich #cucumbersendwich #shortsvideo #reels #recipe
    April 27, 2026
    Healthy Cucumber Sandwich Recipe  #ytshorts #food #trending #viral #recipe #explore#sandwich Healthy Cucumber Sandwich Recipe #ytshorts #food #trending #viral #recipe #explore#sandwich
    April 26, 2026
    High Protein Toast & Sandwich | Healthy Ragi Bread Recipe | Easy 5 Min Breakfast #recipe High Protein Toast & Sandwich | Healthy Ragi Bread Recipe | Easy 5 Min Breakfast #recipe
    April 26, 2026
    Sandwich Green Chutney #viral #chutney #SteamyKitchenBells #shorts #street #youtube Sandwich Green Chutney #viral #chutney #SteamyKitchenBells #shorts #street #youtube
    April 26, 2026
    Previous Next
Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |
Low Calorie

Black pepper cottage cheese | Indian Style | Healthy, Low fat and Quick recipe |

By UCOOK May 10, 2021

# blackpeppercottagecheese
#cottagecheeserecipe
#indianstyleblackpeppercottagecheese
#landofflavors

BlackblackpeppercottagecheesecheeseCottagecottagecheeserecipeCuisineFathealthyHealthy CuisineHealthy IdeasHealthy Low CalorieHealthy Low Calorie IdeasHealthy Low Calorie Recipeshealthy recipesideasIndianIndianstylecottagecheeserecipekalimirchpaneerlandofflavorslow calorieLow Calorie IdeasLow Calorie RecipeslowfatcottagecheeselowfatkalimirchpaneerpaneerrecipepepperquickrecipestyleVideoVlogwithoutcreamblackpeppercottagecheesewithoutcreamkalimirchpaneerYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.