UCOOK: Healthy Ideas
  • Recipes
    khajoor dryfruits laddu recipe/healthy dryfruit laddu #dryfruitsladdu #recipe #shortsviral #healthy khajoor dryfruits laddu recipe/healthy dryfruit laddu #dryfruitsladdu #recipe #shortsviral #healthy
    May 1, 2026
    Crispy Tuna Sushi Nachos @safecatchfoods  #safecatch #healthyrecipes #nyc Crispy Tuna Sushi Nachos @safecatchfoods #safecatch #healthyrecipes #nyc
    May 1, 2026
    Mango Saffron Ice cream! #mangodessert #easyicecreamrecipe #easyrecipe #cookingmadeeasy #healthy Mango Saffron Ice cream! #mangodessert #easyicecreamrecipe #easyrecipe #cookingmadeeasy #healthy
    May 1, 2026
    Flourless tortillas . Healthy, high-protein, and SO easy #flourless #healthyrecipes #highprotein Flourless tortillas . Healthy, high-protein, and SO easy #flourless #healthyrecipes #highprotein
    May 1, 2026
    Follow me on Instagram & Facebook @ GanjaGwyn  #highprotein #lowcarb #healthyrecipes #EasyRecipe Follow me on Instagram & Facebook @ GanjaGwyn #highprotein #lowcarb #healthyrecipes #EasyRecipe
    April 30, 2026
    Previous Next
  • Breakfast
    Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast
    May 1, 2026
    Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts  #foodie  #southindianfood Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts #foodie #southindianfood
    May 1, 2026
    Crispy Soya Manchurian Chunks in 2 Minutes | High Protein Healthy Breakfast Recipe #shorts #recipe Crispy Soya Manchurian Chunks in 2 Minutes | High Protein Healthy Breakfast Recipe #shorts #recipe
    May 1, 2026
    Healthy breakfast recipes#shortvideo #shortsfeed #viralshorts #viralvideo #ytshorts #youtubeshorts Healthy breakfast recipes#shortvideo #shortsfeed #viralshorts #viralvideo #ytshorts #youtubeshorts
    May 1, 2026
    Vegetable Besan Cheese Chilla Recipe | Quick & Healthy Breakfast Vegetable Besan Cheese Chilla Recipe | Quick & Healthy Breakfast
    May 1, 2026
    Previous Next
  • Lunch
    Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox
    May 1, 2026
    Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts
    April 30, 2026
    healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen
    April 30, 2026
    Foods you believe are high in Protein but are not #shorts Foods you believe are high in Protein but are not #shorts
    April 30, 2026
    Banana Chocolate Cake #viralvideo #recipe #food #chocolate #cookingvlog #food #asin #shotsvideo Banana Chocolate Cake #viralvideo #recipe #food #chocolate #cookingvlog #food #asin #shotsvideo
    April 30, 2026
    Previous Next
  • Dinner
    Healthy Soya Pasta #recipe #shortsfeed #cooking #recipe #youtubeshorts #viral Healthy Soya Pasta #recipe #shortsfeed #cooking #recipe #youtubeshorts #viral
    May 1, 2026
    Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy  . Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy .
    May 1, 2026
    My healthy dinner ideas / simple and easy  dinner ideas by shanulagam My healthy dinner ideas / simple and easy dinner ideas by shanulagam
    April 30, 2026
    Chicken Creamy Karahi Recipe #trending #quickrecipe Chicken Creamy Karahi Recipe #trending #quickrecipe
    April 30, 2026
    Would you try these? #healthy #recipe #cookie Would you try these? #healthy #recipe #cookie
    April 30, 2026
    Previous Next
  • Snacks
    Potato '65' recipe #trending #food #shorts #healthy snacks #evening snacks #potato 65 #viral Potato ’65’ recipe #trending #food #shorts #healthy snacks #evening snacks #potato 65 #viral
    May 1, 2026
    Goan Sukrunde | Moong Dumplings #shorts #snacks #traditional #goa #easyrecipe #viral Goan Sukrunde | Moong Dumplings #shorts #snacks #traditional #goa #easyrecipe #viral
    May 1, 2026
    If you are feeling lazy and want to eat momos. If you are feeling lazy and want to eat momos.
    May 1, 2026
    Healthy weight gain snack for babies #ytshorts #food #babyfood #weightgain #snacks #recipe #healthy Healthy weight gain snack for babies #ytshorts #food #babyfood #weightgain #snacks #recipe #healthy
    May 1, 2026
    makhana dahi chaat|makhana dahi bhalla #recipe #food #shorts #recipes #healthyrecipes #healthysnacks makhana dahi chaat|makhana dahi bhalla #recipe #food #shorts #recipes #healthyrecipes #healthysnacks
    May 1, 2026
    Previous Next
  • Weight Loss
    Steamed vegetables recipe | Healthy breakfast ideas #viral #shorts #food #health #recipe Steamed vegetables recipe | Healthy breakfast ideas #viral #shorts #food #health #recipe
    May 1, 2026
    #jowardosa #healthydosa #weightloss #diabetescontrol #healthyfood #indianfood #millets #jowardosa #healthydosa #weightloss #diabetescontrol #healthyfood #indianfood #millets
    April 30, 2026
    Garmi Me Best Dinner! Lauki Ka Raita | Weight Loss Recipe #lax_poo #laukiraita #shorts Garmi Me Best Dinner! Lauki Ka Raita | Weight Loss Recipe #lax_poo #laukiraita #shorts
    April 30, 2026
    Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending
    April 30, 2026
    Protein Se Bharpoor Soya Chilla | Healthy Fitness Breakfast #weightloss #shorts #nomaida Protein Se Bharpoor Soya Chilla | Healthy Fitness Breakfast #weightloss #shorts #nomaida
    April 30, 2026
    Previous Next
  • Low Calorie
    Beef Goulash Pasta High Protein Meal Prep Recipe #shorts Beef Goulash Pasta High Protein Meal Prep Recipe #shorts
    April 30, 2026
    Sobremesa fit baixa caloria Sobremesa fit baixa caloria
    April 30, 2026
    Weight Loss Protein Rich diet #shorts#shortsfeed #food #trending #ytstudio #viral #youtubeshorts Weight Loss Protein Rich diet #shorts#shortsfeed #food #trending #ytstudio #viral #youtubeshorts
    April 30, 2026
    #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip
    April 30, 2026
    Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt! Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt!
    April 30, 2026
    Previous Next
  • Salad
    Viral Cucumber Salad Recipe || Summer Cooler Recipe In Odia ...#shorts #youtubeshorts #viral #odia Viral Cucumber Salad Recipe || Summer Cooler Recipe In Odia …#shorts #youtubeshorts #viral #odia
    May 1, 2026
    Chickpea salad recipe | Healthy salad for weightlose |#shortsfeed #youtubeshorts #shortsviral #short Chickpea salad recipe | Healthy salad for weightlose |#shortsfeed #youtubeshorts #shortsviral #short
    May 1, 2026
    Healthy Sprouts Salad Recipe | @RanjusKitchen1984 #shorts Healthy Sprouts Salad Recipe | @RanjusKitchen1984 #shorts
    May 1, 2026
    Crispy Cabbage Tuna Salad with Sweet Raisins | Quick & Healthy Mediterranean Recipe #healthyrecipes Crispy Cabbage Tuna Salad with Sweet Raisins | Quick & Healthy Mediterranean Recipe #healthyrecipes
    April 30, 2026
    Kohlrabi Salad That Tastes Better Than It Looks #recipe #healthysalad #summer Kohlrabi Salad That Tastes Better Than It Looks #recipe #healthysalad #summer
    April 30, 2026
    Previous Next
  • Bread
    Healthy Dahi Toast recipe | Dahi toast Recipe | Protein rich dahi toast | #shorts #viral #tasty Healthy Dahi Toast recipe | Dahi toast Recipe | Protein rich dahi toast | #shorts #viral #tasty
    May 1, 2026
    Easy Besan Bread Recipe | Perfect Healthy Snack & Breakfast Easy Besan Bread Recipe | Perfect Healthy Snack & Breakfast
    May 1, 2026
    Easy French Bread Breakfast! Cheesy Recipe #shorts Easy French Bread Breakfast! Cheesy Recipe #shorts
    April 30, 2026
    Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure
    April 30, 2026
    Keto Breads by Kelley Herring Review Real Tasting Keto Bread Recipe Keto Breads by Kelley Herring Review Real Tasting Keto Bread Recipe
    April 30, 2026
    Previous Next
  • Sandwich
    Crispy Cheesy Corn Sandwich That's Actually Healthy #shorts #recipe #sandwich Crispy Cheesy Corn Sandwich That’s Actually Healthy #shorts #recipe #sandwich
    May 1, 2026
    Carrot Flatbread Instead of Bread! NoFlour, Air Fryer Carrot Flatbread Instead of Bread! NoFlour, Air Fryer
    April 30, 2026
    Easy Cucumber Cheese Sandwich Recipe | Quick & Healthy Snack#shorts #food Easy Cucumber Cheese Sandwich Recipe | Quick & Healthy Snack#shorts #food
    April 30, 2026
    How to Cook 100 MASSIVE Scratch Made Freezer Meals | Filling My Freezer for My Family of 10 How to Cook 100 MASSIVE Scratch Made Freezer Meals | Filling My Freezer for My Family of 10
    April 30, 2026
    Fast & Easy Chicken Parm Sandwich Fast & Easy Chicken Parm Sandwich
    April 30, 2026
    Previous Next
#shorts# Healthy instant Tiffin-Milk Bread/Breakfast for Everyone || @Petukfoodie.Priyanka
Bread

#shorts# Healthy instant Tiffin-Milk Bread/Breakfast for Everyone || @Petukfoodie.Priyanka

By UCOOK December 5, 2022

Please subscribe to my channel 🙏 @Petukfoodie.Priyanka || To watch more videos like this Subscribe to my YouTube Channel || #Petukfoodie
#shorts
#shortsvideo
#Viral

#healthybreakfastBreadBread IdeasBread RecipesbreadbreakfastCuisinehealthyHealthy BreadHealthy Bread IdeasHealthy Bread RecipesHealthy CuisineHealthy Ideashealthy recipeshealthytifinideasinstantmilkbreadPetukfoodie.PriyankarecipeshortsTiffinMilkVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.