UCOOK: Healthy Ideas
  • Recipes
    Make a Raw Mango Thai Salad with me! #salad #saladrecipe #weightloss #healthy #healthyrecipes Make a Raw Mango Thai Salad with me! #salad #saladrecipe #weightloss #healthy #healthyrecipes
    April 25, 2026
    Healthy Cucumber Salad Recipe | Fresh & Refreshing Summer Salad #CucumberSalad #SummerSaladRecipe Healthy Cucumber Salad Recipe | Fresh & Refreshing Summer Salad #CucumberSalad #SummerSaladRecipe
    April 25, 2026
    Realistic healthy meals ! How’s your Saturday going so far? #glp1 #glp1journey #glp1meals #healthy Realistic healthy meals ! How’s your Saturday going so far? #glp1 #glp1journey #glp1meals #healthy
    April 25, 2026
    Healthy Sugar Free Kulfi Recipe | No Sugar Ice Cream | Easy Dry Fruit Kulfi #shorts Healthy Sugar Free Kulfi Recipe | No Sugar Ice Cream | Easy Dry Fruit Kulfi #shorts
    April 25, 2026
    High Protin evening snack #viral #recipe #yt #healthyrecipes #food #diet #weightloss #cooking High Protin evening snack #viral #recipe #yt #healthyrecipes #food #diet #weightloss #cooking
    April 25, 2026
    Previous Next
  • Breakfast
    These 6 Foods Should Be in Your Breakfast | Healthy Breakfast Ideas These 6 Foods Should Be in Your Breakfast | Healthy Breakfast Ideas
    April 25, 2026
    Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts Delicious and Healthy Breakfast #breakfast #easyrecipe #shorts
    April 25, 2026
    Vermicelli Upma # Healthy Breakfast Recipe #ExplorerApoorvaFoodVlogs. Vermicelli Upma # Healthy Breakfast Recipe #ExplorerApoorvaFoodVlogs.
    April 25, 2026
    Instant Recipe | Healthy Breakfast Idea #healthybreakfast #instantrecipe Instant Recipe | Healthy Breakfast Idea #healthybreakfast #instantrecipe
    April 25, 2026
    No Junk ! Healthy Breakfast Recipes | Kids Lunchbox | Easy Indian Breakfast | Tiffin Recipes No Junk ! Healthy Breakfast Recipes | Kids Lunchbox | Easy Indian Breakfast | Tiffin Recipes
    April 25, 2026
    Previous Next
  • Lunch
    #cookwithniku #trending #mangojamrecipe #jamrecipe #food #healthy #viral #viralshorts #shorts #mango #cookwithniku #trending #mangojamrecipe #jamrecipe #food #healthy #viral #viralshorts #shorts #mango
    April 25, 2026
    Best Breakfast For Diabetics - Barley Porridge!#barley #breakfast #food #recipe #shorts #shortsfeed Best Breakfast For Diabetics – Barley Porridge!#barley #breakfast #food #recipe #shorts #shortsfeed
    April 25, 2026
    Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas #food #husband #healthy Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas #food #husband #healthy
    April 25, 2026
    #mangofishcurry # #lunchideas #healthy lunch for summer #. #mangofishcurry # #lunchideas #healthy lunch for summer #.
    April 25, 2026
    healthy lunch box @kesar-vlog healthy lunch box @kesar-vlog
    April 25, 2026
    Previous Next
  • Dinner
    Chick Fil A Breakfast Casserole Meal Prep #shorts Chick Fil A Breakfast Casserole Meal Prep #shorts
    April 25, 2026
    healthy dinner recipe #treanding #viral #cooking #food #dinner #recipe #anitadevshalibhatt healthy dinner recipe #treanding #viral #cooking #food #dinner #recipe #anitadevshalibhatt
    April 25, 2026
    Gluten Free Healthy Chilla Recipe #myjainrecipe Gluten Free Healthy Chilla Recipe #myjainrecipe
    April 25, 2026
    Singdana vali simla mirchi ki sabji | #shortsfeed Singdana vali simla mirchi ki sabji | #shortsfeed
    April 25, 2026
    Quick Soya Pulao Recipe | Healthy & Tasty | #pulao #quickrecipe Quick Soya Pulao Recipe | Healthy & Tasty | #pulao #quickrecipe
    April 25, 2026
    Previous Next
  • Snacks
    murmura ka healthy evening snacks #food #recipe #viral #shorts murmura ka healthy evening snacks #food #recipe #viral #shorts
    April 25, 2026
    Evening Snacks Recipe | Easy And Quick Recipe #shorts #youtubeshorts #trending #snacks Evening Snacks Recipe | Easy And Quick Recipe #shorts #youtubeshorts #trending #snacks
    April 25, 2026
    #khudihandisala #coldcoffee #food #snacks #recipe #cooking #drinks #shortvideo #shortsfeed #khudihandisala #coldcoffee #food #snacks #recipe #cooking #drinks #shortvideo #shortsfeed
    April 25, 2026
    Healthy n quick recipe #cornchat #chat #makairecipe #bhel #viral #ytshorts #foodie #cooking#trending Healthy n quick recipe #cornchat #chat #makairecipe #bhel #viral #ytshorts #foodie #cooking#trending
    April 25, 2026
    Protein rich very healthy chilla for kids #recipe #food #chilla #cooking Protein rich very healthy chilla for kids #recipe #food #chilla #cooking
    April 25, 2026
    Previous Next
  • Weight Loss
    High Protein Paneer Sandwich | Easy Healthy Recipe | Weight Loss Friendly#shorts #paneersandwich High Protein Paneer Sandwich | Easy Healthy Recipe | Weight Loss Friendly#shorts #paneersandwich
    April 25, 2026
    Roasted Chana Chaat Recipe #shorts #shortsfeed #food #chaat #amaarrannabynikunja  #chaatrecipe Roasted Chana Chaat Recipe #shorts #shortsfeed #food #chaat #amaarrannabynikunja #chaatrecipe
    April 25, 2026
    Tasty Soyabean Chunks ka nashta #youtubeshorts #recipe #feed #healthysnacks Tasty Soyabean Chunks ka nashta #youtubeshorts #recipe #feed #healthysnacks
    April 25, 2026
    Easy and healthy weight loss drink | babyskitchen #shorts Easy and healthy weight loss drink | babyskitchen #shorts
    April 25, 2026
    Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe Sesame Beetroot Chapati & Makhana Raita | Healthy Weight Loss Recipe
    April 25, 2026
    Previous Next
  • Low Calorie
    This entire breakfast was only 370 cals and 52g of protein! #lowcalorie #highprotein #mealideas This entire breakfast was only 370 cals and 52g of protein! #lowcalorie #highprotein #mealideas
    April 25, 2026
    Protein blanket dumplings with 38g protein #ytshorts #recipe Protein blanket dumplings with 38g protein #ytshorts #recipe
    April 25, 2026
    Dr Manishaa's Secrets For Naturally Glowing & Shiny Skin! #easyrecipe  #glowingskin Dr Manishaa’s Secrets For Naturally Glowing & Shiny Skin! #easyrecipe #glowingskin
    April 25, 2026
    Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak Chickpea Hummus and Cauliflower Steak Recipe#viral#viralvideo #youtubeshorts#food #cauliflowersteak
    April 25, 2026
    kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe kya aapane kabhi lauki ka kofta banae Hain#ytshorts @foodandhow #recipe
    April 25, 2026
    Previous Next
  • Salad
    Skip heavy meals this summer & make this wholesome & refreshing salad! #salad #viral #food #recipe Skip heavy meals this summer & make this wholesome & refreshing salad! #salad #viral #food #recipe
    April 25, 2026
    Healthy Weight Loss Salad Recipe | Healthy Weight Loss Recipe | Healthy Easy Salad Recipe Healthy Weight Loss Salad Recipe | Healthy Weight Loss Recipe | Healthy Easy Salad Recipe
    April 25, 2026
    Healthy Salad Recipe | Chana Lobia Salad Recipe | Weight Loss Recipe | Healthy Salad Recipe | Chana Lobia Salad Recipe | Weight Loss Recipe |
    April 25, 2026
    Strawberry Banana Salad Recipe | Healthy Salad Recipes | Creamy Fruit Salad | Salad Recipe Strawberry Banana Salad Recipe | Healthy Salad Recipes | Creamy Fruit Salad | Salad Recipe
    April 25, 2026
    Channa Salad recipe | healthy breakfast #chana  #healtyfood #healthybreakfast #breakfast Channa Salad recipe | healthy breakfast #chana #healtyfood #healthybreakfast #breakfast
    April 25, 2026
    Previous Next
  • Bread
    Healthy Breakfast Banana Muffins #shorts #muffins #recipe #bananabread Healthy Breakfast Banana Muffins #shorts #muffins #recipe #bananabread
    April 25, 2026
    Stop Eating Bread! Try This High Protein Healthy Breakfast | Lunch Box | Tiffin Recipes | Breakfast Stop Eating Bread! Try This High Protein Healthy Breakfast | Lunch Box | Tiffin Recipes | Breakfast
    April 25, 2026
    easy tasty healthy mithaai recipe#bread sweets dessert#recipe#health#food easy tasty healthy mithaai recipe#bread sweets dessert#recipe#health#food
    April 25, 2026
    healthy bread roll recipe #bread roll #ytshorts healthy bread roll recipe #bread roll #ytshorts
    April 25, 2026
    Just Oats & Water! No Sugar, No Yeast! This Healthy Bread Has Gone Viral! Just Oats & Water! No Sugar, No Yeast! This Healthy Bread Has Gone Viral!
    April 25, 2026
    Previous Next
  • Sandwich
    Triple C Sandwich Recipe | Creamy Veg Sandwich | No Cook Easy Sandwich Recipe Triple C Sandwich Recipe | Creamy Veg Sandwich | No Cook Easy Sandwich Recipe
    April 25, 2026
    5 Super detox combo juice #nls #naturallifestyle #healthyfood #curedetox #food #facts 5 Super detox combo juice #nls #naturallifestyle #healthyfood #curedetox #food #facts
    April 25, 2026
    Healthy sandwich for breakfast || deep food recipes #like #recipe #food #healthysandwich #breakfast Healthy sandwich for breakfast || deep food recipes #like #recipe #food #healthysandwich #breakfast
    April 25, 2026
    Healthy 5 Min Easy Brown Bread Paneer  Sandwich Breakfast Recipe #shorts #breakfast #sandwich Healthy 5 Min Easy Brown Bread Paneer Sandwich Breakfast Recipe #shorts #breakfast #sandwich
    April 25, 2026
    celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts celebrity special french toast #shilpa shetty favourite dish#sandwich#easy breakfast #foodie#shorts
    April 25, 2026
    Previous Next
A HEALTHY CHICKEN BURGER WITHOUT BREAD BUNS
Sandwich

A HEALTHY CHICKEN BURGER WITHOUT BREAD BUNS

By UCOOK May 28, 2025



This is a guilt free snack, juicy, tasty and easy to make. Just use the okonomiyaki style for the bun.

BreadBunsBurgerchickenCuisinehealthyHealthy CuisineHealthy Ideashealthy recipesHealthy SandwichHealthy Sandwich IdeasHealthy Sandwich RecipesHow to make a guilt free snack for weight losshow to make a healthy burgerhow to make a healthy chicken burgerHow to make Okonomiyakiideasrecipesandwichsandwich ideassandwich recipesVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.