UCOOK: Healthy Ideas
  • Recipes
    3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy 3-Ingredient Banana Egg Pancakes (High Protein!) #recipe #breakfast #healthy
    April 29, 2026
    Air Fryer Bhindi Sabji Recipe | Crispy Bhindi Fry | Easy Okra Fry | Healthy viral Recipe #shorts Air Fryer Bhindi Sabji Recipe | Crispy Bhindi Fry | Easy Okra Fry | Healthy viral Recipe #shorts
    April 29, 2026
    chicken Roll #Healthy recipes healthy way by irshu chicken Roll #Healthy recipes healthy way by irshu
    April 29, 2026
    healthy recipes dr sivaraman speech# recipeshortfeed# keralapayarupuzhukkurecipe#lunch& breakfast# healthy recipes dr sivaraman speech# recipeshortfeed# keralapayarupuzhukkurecipe#lunch& breakfast#
    April 29, 2026
    Healthy Beetroot Idli Recipe Try Once !! #shorts #food #cooking #easyrecipe #idli Healthy Beetroot Idli Recipe Try Once !! #shorts #food #cooking #easyrecipe #idli
    April 29, 2026
    Previous Next
  • Breakfast
    sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo sprouted chana salad |healthy breakfast recipe #shorts #salad #viralvideo
    April 29, 2026
    Protein rich Breakfast Idea | Achari Chole Paratha | Healthy Breakfast Series | #breakfast #recipe Protein rich Breakfast Idea | Achari Chole Paratha | Healthy Breakfast Series | #breakfast #recipe
    April 29, 2026
    Healthy breakfast recipes #alhamdulillah #deliciousfood #recipe #lifestyle #viralvideo Healthy breakfast recipes #alhamdulillah #deliciousfood #recipe #lifestyle #viralvideo
    April 29, 2026
    Healthy breakfast fruits recipe by Manish Acharya ji #fruits #shots #food #breakfast #shortvideo Healthy breakfast fruits recipe by Manish Acharya ji #fruits #shots #food #breakfast #shortvideo
    April 29, 2026
    Kya aapne yeh healthy breakfast recipe try ki hai ? #shorts #breakfast Kya aapne yeh healthy breakfast recipe try ki hai ? #shorts #breakfast
    April 29, 2026
    Previous Next
  • Lunch
    Summer Special Weight Loss Salad #ytshorts #viralvideo #weightloss #healthy #viral #shorts Summer Special Weight Loss Salad #ytshorts #viralvideo #weightloss #healthy #viral #shorts
    April 29, 2026
    Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas#husband #healthy #homemade Lunchbox Ideas #tiffin #shorts #trending #lunchbox #lunch #lunchboxideas#husband #healthy #homemade
    April 29, 2026
    mung daal ka healthy nashta#resturent #cooking #recipe #viral recipe#viral lunch box  #ytshorts mung daal ka healthy nashta#resturent #cooking #recipe #viral recipe#viral lunch box #ytshorts
    April 29, 2026
    healthy breakfast and lunch recipes#vizagvlogs #food #cooking #recipe healthy breakfast and lunch recipes#vizagvlogs #food #cooking #recipe
    April 29, 2026
    Healthy Lunchbox Ideas #kidslunchbox  #lunchboxideas #lunchboxrecipe #healthylunch #balanceddiet Healthy Lunchbox Ideas #kidslunchbox #lunchboxideas #lunchboxrecipe #healthylunch #balanceddiet
    April 29, 2026
    Previous Next
  • Dinner
    2 Minutes Recipe | raita recipe | banana recipe | #shorts #raita #momofhungrykids 2 Minutes Recipe | raita recipe | banana recipe | #shorts #raita #momofhungrykids
    April 29, 2026
    Easy Snacks Eggs Recipe || Eggs Recipe In Odia...#shorts #trending #youtubeshorts #odia Easy Snacks Eggs Recipe || Eggs Recipe In Odia…#shorts #trending #youtubeshorts #odia
    April 29, 2026
    Curd semiya recipe #trending #food #shorts #healthy food #curd semiya #cooking #viral food Curd semiya recipe #trending #food #shorts #healthy food #curd semiya #cooking #viral food
    April 29, 2026
    Healthy dinner ideas in my 40s #over40 #healthyfood #wellness #sponsored #ads Healthy dinner ideas in my 40s #over40 #healthyfood #wellness #sponsored #ads
    April 29, 2026
    Weight loss rice bowl that doesn’t feel healthy #shorts #youtubeshorts #viral #trending #highprotein Weight loss rice bowl that doesn’t feel healthy #shorts #youtubeshorts #viral #trending #highprotein
    April 29, 2026
    Previous Next
  • Snacks
    High Protein Crispy Kebabs | #healthyeating #recipe High Protein Crispy Kebabs | #healthyeating #recipe
    April 29, 2026
    Market-Style Moong Dal | Air Fryer Recipe | Healthy Snack for Kids | Only 3 Ingredients #viralshort Market-Style Moong Dal | Air Fryer Recipe | Healthy Snack for Kids | Only 3 Ingredients #viralshort
    April 29, 2026
    Crispy Lentil Snacks | Healthy High-Protein Chips (Gluten-Free) Crispy Lentil Snacks | Healthy High-Protein Chips (Gluten-Free)
    April 29, 2026
    Roasted Masala makhana in just 5 min | Healthy Evening Snacks #shorts #explore  #eveningsnacks Roasted Masala makhana in just 5 min | Healthy Evening Snacks #shorts #explore #eveningsnacks
    April 29, 2026
    10 Minutes Healthy Breakfast  | Kids Lunchbox Recipes | snacks/ Easy Breakfast recipe 10 Minutes Healthy Breakfast | Kids Lunchbox Recipes | snacks/ Easy Breakfast recipe
    April 29, 2026
    Previous Next
  • Weight Loss
    Pumpkin Dosa | Tasty Healthy Recipe for Weight Loss | Latest updates | DAR FOCUS Pumpkin Dosa | Tasty Healthy Recipe for Weight Loss | Latest updates | DAR FOCUS
    April 29, 2026
    Istam ga  Thintu  Weight loss Protein Dosa#youtubevideo #cooking #masala dosa#vegdosa Istam ga Thintu Weight loss Protein Dosa#youtubevideo #cooking #masala dosa#vegdosa
    April 29, 2026
    Protein Rich Sprouts Salad | High protein breakfast | Weight loss diet #youtubeshorts#healthy#shorts Protein Rich Sprouts Salad | High protein breakfast | Weight loss diet #youtubeshorts#healthy#shorts
    April 29, 2026
    High Protein Chickpea Salad Recipe | Healthy Weight Loss Salad | Easy Protein Rich Meal| Quick Salad High Protein Chickpea Salad Recipe | Healthy Weight Loss Salad | Easy Protein Rich Meal| Quick Salad
    April 29, 2026
    #babygirl #babygirl
    April 29, 2026
    Previous Next
  • Low Calorie
    “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food “2-Minute Watermelon Juice Recipe | Cool & Hydrating” #recipe #shorts #food
    April 29, 2026
    Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food Ragi Idli #ragi #shorts ##milletsrecipe#yt #Indianbreakfast #recipe #indianfood #food
    April 29, 2026
    Healthy Breakfast - Moongdal ka chilla | Viral Recipe |#viral #cooking #newrecipe Healthy Breakfast – Moongdal ka chilla | Viral Recipe |#viral #cooking #newrecipe
    April 29, 2026
    Meal prep for the week! What do you want the recipe for? I used some ingredients in both (to save Meal prep for the week! What do you want the recipe for? I used some ingredients in both (to save
    April 29, 2026
    Healthy chicken tacos! Theyre just under 300 calories for... #Shorts #carolineefitness25 Healthy chicken tacos! Theyre just under 300 calories for… #Shorts #carolineefitness25
    April 28, 2026
    Previous Next
  • Salad
    Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees | Delicious Fresh Salad Recipe | Easy & Healthy Salad | Food Diary by Anees |
    April 29, 2026
    Healthy salad || vegetable salad || No mayonnaise || #food #healthy #ytshorts #recipe #foodie #viral Healthy salad || vegetable salad || No mayonnaise || #food #healthy #ytshorts #recipe #foodie #viral
    April 29, 2026
    Dahi kakdi salad with jeera tadka -cool & healthy #short Dahi kakdi salad with jeera tadka -cool & healthy #short
    April 29, 2026
    Perfect Salad foe Weightloss #healthy #food #recipe #weightloss #easyrecipe #shorts #trending Perfect Salad foe Weightloss #healthy #food #recipe #weightloss #easyrecipe #shorts #trending
    April 29, 2026
    Pure Coconut Oil at home #shorts #coconutoil #homemade #spiceupflavourskitchen Pure Coconut Oil at home #shorts #coconutoil #homemade #spiceupflavourskitchen
    April 29, 2026
    Previous Next
  • Bread
    bread cutlet recipe#trending #food #healthy#snacksshorts bread cutlet recipe#trending #food #healthy#snacksshorts
    April 29, 2026
    Bread flower pizza |easy tasty recipes #foodie #shorts #healthy Bread flower pizza |easy tasty recipes #foodie #shorts #healthy
    April 29, 2026
    Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box Stop Eating Bread!! TRY this No Maida less Oil Instant Healthy Veg Breakfast| Perfect Kids lunch box
    April 29, 2026
    The BEST chocolate banana bread ever!! | Healthy baking The BEST chocolate banana bread ever!! | Healthy baking
    April 28, 2026
    Healthy and wholesome bread in mugs in 5 minutes! No sugar! No white flour! Healthy and wholesome bread in mugs in 5 minutes! No sugar! No white flour!
    April 28, 2026
    Previous Next
  • Sandwich
    Healthy breakfast recipes#viralvideo #shortvideo #shortsfeed #shorts #trending #ytshorts Healthy breakfast recipes#viralvideo #shortvideo #shortsfeed #shorts #trending #ytshorts
    April 29, 2026
    Cafe Style Panner Veg Sandwich | Sandwich Recipe | Cafe Style Panner Veg Sandwich | Sandwich Recipe |
    April 29, 2026
    5-Minute School Lunch Box Recipes #food #viral #trending #video #shorts #recipe #easyrecipe #fuuny 5-Minute School Lunch Box Recipes #food #viral #trending #video #shorts #recipe #easyrecipe #fuuny
    April 29, 2026
    HIGH PROTEIN Sandwiches Part 3: Caesar, Egg Salad & Chick-fil-A #shorts #highprotein #sandwiches HIGH PROTEIN Sandwiches Part 3: Caesar, Egg Salad & Chick-fil-A #shorts #highprotein #sandwiches
    April 29, 2026
    High Protein Paneer Sandwich Recipe | Crispy Grilled Paneer Sandwich | Kashyap Kitchen #recipe #food High Protein Paneer Sandwich Recipe | Crispy Grilled Paneer Sandwich | Kashyap Kitchen #recipe #food
    April 28, 2026
    Previous Next
Calories difference in 1 whole egg vs 1 Egg white#fitness#gym#dietplan#weightloss#healthy life#egg#
Low Calorie

Calories difference in 1 whole egg vs 1 Egg white#fitness#gym#dietplan#weightloss#healthy life#egg#

By UCOOK August 1, 2024

CaloriesCuisineDIFFERENCEegghealthyHealthy CuisineHealthy IdeasHealthy Low CalorieHealthy Low Calorie IdeasHealthy Low Calorie Recipeshealthy recipesideaslifeegglow calorieLow Calorie IdeasLow Calorie RecipesrecipeVideoVlogwhitefitnessgymdietplanweightlosshealthyYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.