UCOOK: Healthy Ideas
  • Recipes
    2026 Snail Recipes #viralvideo #yummy #healthy #protein #reels #fyp 2026 Snail Recipes #viralvideo #yummy #healthy #protein #reels #fyp
    June 22, 2026
    zesty Beef & Cabbage Stew #food #highprotein #yummy #yum #healthyrecipes #easyrecipe #cooking zesty Beef & Cabbage Stew #food #highprotein #yummy #yum #healthyrecipes #easyrecipe #cooking
    June 22, 2026
    Easy & Creamy Corn Salad Recipe | Fresh, Healthy & Delicious Corn Salad Easy & Creamy Corn Salad Recipe | Fresh, Healthy & Delicious Corn Salad
    June 22, 2026
    #falafelrecipe #healthyrecipes #proteinbowl #healthyfood #airfryerrecipes #proteindiet #proteinsalad #falafelrecipe #healthyrecipes #proteinbowl #healthyfood #airfryerrecipes #proteindiet #proteinsalad
    June 22, 2026
    Healthy Breakfast Recipe | 10 min Upma with Beetroot Sauce #shorts #shortsfeed #upma #breakfast Healthy Breakfast Recipe | 10 min Upma with Beetroot Sauce #shorts #shortsfeed #upma #breakfast
    June 22, 2026
    Previous Next
  • Breakfast
    Gehu Ke Aate Se Banaye Healthy Breakfast | Itna Tasty Ki Roz Banana Padega Gehu Ke Aate Se Banaye Healthy Breakfast | Itna Tasty Ki Roz Banana Padega
    June 22, 2026
    Healthy Breakfast Recipes Everyone Should Try #shortfeed #viral Healthy Breakfast Recipes Everyone Should Try #shortfeed #viral
    June 22, 2026
    The Creamiest Avocado Banana Smoothie You'll Ever Make | Healthy Breakfast Recipe #shorts The Creamiest Avocado Banana Smoothie You’ll Ever Make | Healthy Breakfast Recipe #shorts
    June 22, 2026
    40g Protein Moong Paneer Chilla | Weight Loss Recipe | Easy Breakfast Recipe #HighProteinRecipes 40g Protein Moong Paneer Chilla | Weight Loss Recipe | Easy Breakfast Recipe #HighProteinRecipes
    June 22, 2026
    12 High-Protein Indian Breakfast Recipes | Healthy Breakfast for Weight Loss, PCOS & Thyroid 12 High-Protein Indian Breakfast Recipes | Healthy Breakfast for Weight Loss, PCOS & Thyroid
    June 22, 2026
    Previous Next
  • Lunch
    Tadka dahi #food #recipe #healthy #dahitadkarecipe #youtubeshorts #shortvideo #shorts Tadka dahi #food #recipe #healthy #dahitadkarecipe #youtubeshorts #shortvideo #shorts
    June 22, 2026
    #Noolkol Kootu #shortsfeed #shortsvideo #Turnip kootu #easy #healthy #tasty #Noolkol Kootu #shortsfeed #shortsvideo #Turnip kootu #easy #healthy #tasty
    June 22, 2026
    Office Lunch Box | East & Healthy Lunch Idea | Homemade #shorts #food #viral #lunchbox #office Office Lunch Box | East & Healthy Lunch Idea | Homemade #shorts #food #viral #lunchbox #office
    June 22, 2026
    Easy & Healthy Monday Lunch Thali Idea#CookingAllTime#shorts#viral#trending#lunch#healthy#easy#food Easy & Healthy Monday Lunch Thali Idea#CookingAllTime#shorts#viral#trending#lunch#healthy#easy#food
    June 22, 2026
    Crunchy Moong Dal Namkeen | Healthy Snack Replacement | #healthy #easy #cooking #food Crunchy Moong Dal Namkeen | Healthy Snack Replacement | #healthy #easy #cooking #food
    June 22, 2026
    Previous Next
  • Dinner
    Instant dinner recipes indian/cooking videos recipes indian/healthy dinner recipes indian Instant dinner recipes indian/cooking videos recipes indian/healthy dinner recipes indian
    June 22, 2026
    mango cheese cake recipe- high protein & healthy #shorts #cheesecake #healthy mango cheese cake recipe- high protein & healthy #shorts #cheesecake #healthy
    June 22, 2026
    Dinner bowl #ytshorts #dinnerideas #healthy #paneerrecipe #nocookingrecipes Dinner bowl #ytshorts #dinnerideas #healthy #paneerrecipe #nocookingrecipes
    June 22, 2026
    Did you love ice Popsicle or Juice ? #popsicle #fruit #papaya #watermelon #recipe #healthy #ice Did you love ice Popsicle or Juice ? #popsicle #fruit #papaya #watermelon #recipe #healthy #ice
    June 22, 2026
    Lunch prep for the week! #wife #recipe #cooking #baking #food #mealprep #healthy #easyrecipe #yum Lunch prep for the week! #wife #recipe #cooking #baking #food #mealprep #healthy #easyrecipe #yum
    June 22, 2026
    Previous Next
  • Snacks
    Snacks Recipe. Crispy Tea Time Snacks At Home. Quick Evening Snack Ideas.#shortsfeed#shorts#vantalu Snacks Recipe. Crispy Tea Time Snacks At Home. Quick Evening Snack Ideas.#shortsfeed#shorts#vantalu
    June 22, 2026
    Farah Khan’s Favourite Paneer Tikka Recipe #shorts #farahkhan #paneertikka #viral #food Farah Khan’s Favourite Paneer Tikka Recipe #shorts #farahkhan #paneertikka #viral #food
    June 22, 2026
    Pottukadalai Ladoo, 2 -Ingredient Healthy Snack #shortvideo #shorts #trending #healthyrecipes #viral Pottukadalai Ladoo, 2 -Ingredient Healthy Snack #shortvideo #shorts #trending #healthyrecipes #viral
    June 22, 2026
    Moong Dal Aloo Paneer Tikki Recipe | Healthy Protein Snacks #recipe #cooking #shortvideo Moong Dal Aloo Paneer Tikki Recipe | Healthy Protein Snacks #recipe #cooking #shortvideo
    June 22, 2026
    Aam Papad Recipe | Homemade Mango Fruit Leather | Easy Summer Sweet Snack#shorts #viral#aampapad Aam Papad Recipe | Homemade Mango Fruit Leather | Easy Summer Sweet Snack#shorts #viral#aampapad
    June 22, 2026
    Previous Next
  • Weight Loss
    Paneer & Corn Salad Recipe |Weight lose recepies Episode 1/30 Healthy High Protein Salad Paneer & Corn Salad Recipe |Weight lose recepies Episode 1/30 Healthy High Protein Salad
    June 22, 2026
    Zero oil, 50g protein & unbelievably delicious pasta #shorts #shortsfeed #highprotein #fyp #recipe Zero oil, 50g protein & unbelievably delicious pasta #shorts #shortsfeed #highprotein #fyp #recipe
    June 22, 2026
    Sprouts Chaat | Healthy snacks | Protien rich snacks Sprouts Chaat | Healthy snacks | Protien rich snacks
    June 22, 2026
    New weightloss series Monday Lunch Day -1 #shorts #dietplan New weightloss series Monday Lunch Day -1 #shorts #dietplan
    June 22, 2026
    5-minute no-cook weight loss recipe #weightloss #health #recipes #fatloss #5minuterecipe #easyrecipe 5-minute no-cook weight loss recipe #weightloss #health #recipes #fatloss #5minuterecipe #easyrecipe
    June 22, 2026
    Previous Next
  • Low Calorie
    Are Low Calorie Sauces Actually Good? 10 Calorie Green Sauce and 45 Calorie Berry Jam Recipe Are Low Calorie Sauces Actually Good? 10 Calorie Green Sauce and 45 Calorie Berry Jam Recipe
    June 23, 2026
    How easy is it for fat-reducing people to cook#Fat loss period#Low-calorie and low-fat mea How easy is it for fat-reducing people to cook#Fat loss period#Low-calorie and low-fat mea
    June 22, 2026
    masala makhana recipe #shorts #healthy #lowcalorie #makhana masala makhana recipe #shorts #healthy #lowcalorie #makhana
    June 22, 2026
    Healthy breakfast recipes#viralvideo #viralshorts #shortsvideo #trending #ytshorts Healthy breakfast recipes#viralvideo #viralshorts #shortsvideo #trending #ytshorts
    June 22, 2026
    High Protein Rice Bowl for Weight Loss #shorts #youtubeshorts #viral #trending #weightloss #healthy High Protein Rice Bowl for Weight Loss #shorts #youtubeshorts #viral #trending #weightloss #healthy
    June 22, 2026
    Previous Next
  • Salad
    Coconut peanut salad#wet loss salad#Healthy recipe Coconut peanut salad#wet loss salad#Healthy recipe
    June 22, 2026
    Healthy Snackle boxes to go! #salad #sandwhiches #foodie #snacks #healthy Healthy Snackle boxes to go! #salad #sandwhiches #foodie #snacks #healthy
    June 22, 2026
    Healthy Salad #food #viralvideo #viralshorts #salad #healthy #youtubeshorts Healthy Salad #food #viralvideo #viralshorts #salad #healthy #youtubeshorts
    June 22, 2026
    Rich protein salad recipe #healthy #cooking # daily dish by kavita 101 Rich protein salad recipe #healthy #cooking # daily dish by kavita 101
    June 22, 2026
    This salad recipe is absolutely delicious and healthy This salad recipe is absolutely delicious and healthy
    June 22, 2026
    Previous Next
  • Bread
    Sunday Recipes #shorts Sunday Recipes #shorts
    June 22, 2026
    HEALTHY PROTEIN BREAD / #food #instagram #independentartist #recipe #cooking #desikitchen #foodie HEALTHY PROTEIN BREAD / #food #instagram #independentartist #recipe #cooking #desikitchen #foodie
    June 22, 2026
    Stop Eating Bread! Try This Healthy Breakfast Recipe | Tiffin Recipes | Breakfast Recipes Stop Eating Bread! Try This Healthy Breakfast Recipe | Tiffin Recipes | Breakfast Recipes
    June 22, 2026
    High Protein Toast Recipe | Quick & Healthy Snack Idea #shorts High Protein Toast Recipe | Quick & Healthy Snack Idea #shorts
    June 22, 2026
    Green Chutney Sandwich Bites ASMR | Quick Healthy Indian Snack  #healthyeating Green Chutney Sandwich Bites ASMR | Quick Healthy Indian Snack #healthyeating
    June 22, 2026
    Previous Next
  • Sandwich
    Double Decker Sandwich #avocado #cheese #vegetables #sandwich #viral #shorts #food #recipe #foodie Double Decker Sandwich #avocado #cheese #vegetables #sandwich #viral #shorts #food #recipe #foodie
    June 22, 2026
    Banana French Toast recipe! Healthy breakfast ideas! Sandwich recipe ! #shorts #frenchtoast Banana French Toast recipe! Healthy breakfast ideas! Sandwich recipe ! #shorts #frenchtoast
    June 22, 2026
    corn palak sandwich recipe Healthy breakfast ideas #recipe #viral #food #easyrecipe corn palak sandwich recipe Healthy breakfast ideas #recipe #viral #food #easyrecipe
    June 22, 2026
    10 Minutes Lazy Morning Recipe - Quick & Easy Breakfast Recipe 10 Minutes Lazy Morning Recipe – Quick & Easy Breakfast Recipe
    June 22, 2026
    Kids Lunchbox series Day -3 #shorts #recipe #lunchbox #momlife #easynutrition Kids Lunchbox series Day -3 #shorts #recipe #lunchbox #momlife #easynutrition
    June 22, 2026
    Previous Next
Healthy Sprouts Salad Recipe for Weight Loss #healthyrecipes #shorts
Weight Loss

Healthy Sprouts Salad Recipe for Weight Loss #healthyrecipes #shorts

By UCOOK May 14, 2026



#sproutssalad #healthyrecipes #healthysnacks #sproutschaat #proteinrich #weightlossfood #quickrecipe #indianfood #healthymeal #saladrecipe #foodlover #homemade #easyrecipes #streetfoodstyle #summerrecipes #viralshorts #ytshorts #shortsfeed #healthyifestyle #foodshorts #mahadev #weightloss #salad #shorts

#easyrecipes#foodshorts#ShortsFeed#sproutssalad#viralshortsCuisinefoodloverhealthyHealthy CuisineHealthy Ideashealthy recipesHealthy Weight LossHealthy Weight Loss IdeasHealthy weight loss recipeshealthylifestylehealthymealhealthyrecipeshealthysnackshomemadeideasindianfoodLossmahadevProteinRichQuickReciperecipesaladsaladrecipeshortssproutssproutschaatstreetfoodstylesummerRecipesVideoVlogWeightweight lossWeight Loss IdeasWeight loss recipesWeightLossFoodYouTubeYTShorts

© ucook.org

Top

    Type above and press Enter to search. Press Esc to cancel.