UCOOK: Healthy Ideas
  • Recipes
    #lauki dosa recipe#lauki ka nashta recipe#healthy and quick breakfast recipe#dosa#recipe#shorts #lauki dosa recipe#lauki ka nashta recipe#healthy and quick breakfast recipe#dosa#recipe#shorts
    May 1, 2026
    Healthy mango Ice-cream Recipe #healthy #summer  #icecream  #trending #cooking #recipe Healthy mango Ice-cream Recipe #healthy #summer #icecream #trending #cooking #recipe
    May 1, 2026
    CRISPY PARMESAN CHICKEN & GREEN TAHINI SLAW #easynutrition #healthyrecipes CRISPY PARMESAN CHICKEN & GREEN TAHINI SLAW #easynutrition #healthyrecipes
    May 1, 2026
    Delicious & Healthy - Rajma Smash Burger #smashburger #healthyrecipes Delicious & Healthy – Rajma Smash Burger #smashburger #healthyrecipes
    May 1, 2026
    Fat Loss Nutrition Hack #fatloss #weightloss #healthyrecipes #healthyfood Fat Loss Nutrition Hack #fatloss #weightloss #healthyrecipes #healthyfood
    May 1, 2026
    Previous Next
  • Breakfast
    Healthy breakfast recipe#food#morning breakfast#kitchen Healthy breakfast recipe#food#morning breakfast#kitchen
    May 1, 2026
    Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast Suji Appe Recipe #shorts #viral #food #suji#healthybreakfast
    May 1, 2026
    Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts  #foodie  #southindianfood Rave idly |Easy Breakfast |Healthy breakfast ideas in kannada #shorts #foodie #southindianfood
    May 1, 2026
    Instant Healthy Appe Recipe Healthy Ape Breakfast #viral #shortsfeed #trending #yt #food #ytshorts Instant Healthy Appe Recipe Healthy Ape Breakfast #viral #shortsfeed #trending #yt #food #ytshorts
    May 1, 2026
    Crispy Soya Manchurian Chunks in 2 Minutes | High Protein Healthy Breakfast Recipe #shorts #recipe Crispy Soya Manchurian Chunks in 2 Minutes | High Protein Healthy Breakfast Recipe #shorts #recipe
    May 1, 2026
    Previous Next
  • Lunch
    Pavanipotla 8309114350 #herbalifedindigul #herbalife #wightlose #healthyfood #herbalifenutrition Pavanipotla 8309114350 #herbalifedindigul #herbalife #wightlose #healthyfood #herbalifenutrition
    May 1, 2026
    Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox Healthy Lunch|Dinner recipe |Beans curry |easy recipes| #food #lunch #dinner #easyrecipe #lunchbox
    May 1, 2026
    Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts
    April 30, 2026
    healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen healthy Soya chunk paratha recipe#youtubeshorts #food #shorts #nilamkitchen
    April 30, 2026
    Foods you believe are high in Protein but are not #shorts Foods you believe are high in Protein but are not #shorts
    April 30, 2026
    Previous Next
  • Dinner
    Madhuri Dixit Favourite Food Varan Bhat #shorts #viral #recipe #youtubeshorts #varanbhat #shorts Madhuri Dixit Favourite Food Varan Bhat #shorts #viral #recipe #youtubeshorts #varanbhat #shorts
    May 1, 2026
    Coconut egg recipe #cooking #egg #short 1 May 2026 Coconut egg recipe #cooking #egg #short 1 May 2026
    May 1, 2026
    Acharya Manish ji's SECRET Guava Benefits for Better Health! #shorts #easyrecipe #healthtips Acharya Manish ji’s SECRET Guava Benefits for Better Health! #shorts #easyrecipe #healthtips
    May 1, 2026
    Healthy Soya Pasta #recipe #shortsfeed #cooking #recipe #youtubeshorts #viral Healthy Soya Pasta #recipe #shortsfeed #cooking #recipe #youtubeshorts #viral
    May 1, 2026
    Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy  . Dinner recipes #tastyfood #cooking #minicooking #minivlog @anubhadwivedi1.5mviwes #healthy .
    May 1, 2026
    Previous Next
  • Snacks
    Healthy Snack| Roasted Kaju|#airfryer #snacks #recipe Healthy Snack| Roasted Kaju|#airfryer #snacks #recipe
    May 1, 2026
    Chatpata Masala Makhana Recipe #shorts #youtubeshorts #shortsfeed Chatpata Masala Makhana Recipe #shorts #youtubeshorts #shortsfeed
    May 1, 2026
    Potato '65' recipe #trending #food #shorts #healthy snacks #evening snacks #potato 65 #viral Potato ’65’ recipe #trending #food #shorts #healthy snacks #evening snacks #potato 65 #viral
    May 1, 2026
    Goan Sukrunde | Moong Dumplings #shorts #snacks #traditional #goa #easyrecipe #viral Goan Sukrunde | Moong Dumplings #shorts #snacks #traditional #goa #easyrecipe #viral
    May 1, 2026
    If you are feeling lazy and want to eat momos. If you are feeling lazy and want to eat momos.
    May 1, 2026
    Previous Next
  • Weight Loss
    A very easy and tasty lunch to prepare in summer, Loki Chana Dal #short #viral #recipe #food A very easy and tasty lunch to prepare in summer, Loki Chana Dal #short #viral #recipe #food
    May 1, 2026
    Red Lentil Bread | Weight Loss Recipe Diabetic recipe #shorts #healthy #highprotein #vegan Red Lentil Bread | Weight Loss Recipe Diabetic recipe #shorts #healthy #highprotein #vegan
    May 1, 2026
    The Best Healthy Breakfast | Banana Oat & Seed Pancakes (No Flour!) The Best Healthy Breakfast | Banana Oat & Seed Pancakes (No Flour!)
    May 1, 2026
    High protein oats for fat loss High protein oats for fat loss
    May 1, 2026
    Steamed vegetables recipe | Healthy breakfast ideas #viral #shorts #food #health #recipe Steamed vegetables recipe | Healthy breakfast ideas #viral #shorts #food #health #recipe
    May 1, 2026
    Previous Next
  • Low Calorie
    78g Protein Chilli Chicken Recipe Restaurant Style | Low Calorie Healthy Chicken 78g Protein Chilli Chicken Recipe Restaurant Style | Low Calorie Healthy Chicken
    May 1, 2026
    Viral Boiled egg burger || #shorts #ytshorts #youtubeshorts #youtube #egg Viral Boiled egg burger || #shorts #ytshorts #youtubeshorts #youtube #egg
    May 1, 2026
    Beef Goulash Pasta High Protein Meal Prep Recipe #shorts Beef Goulash Pasta High Protein Meal Prep Recipe #shorts
    April 30, 2026
    Sobremesa fit baixa caloria Sobremesa fit baixa caloria
    April 30, 2026
    Froyo lines are getting out of hand Froyo lines are getting out of hand
    April 30, 2026
    Previous Next
  • Salad
    Viral Cucumber Salad Recipe || Summer Cooler Recipe In Odia ...#shorts #youtubeshorts #viral #odia Viral Cucumber Salad Recipe || Summer Cooler Recipe In Odia …#shorts #youtubeshorts #viral #odia
    May 1, 2026
    Chickpea salad recipe | Healthy salad for weightlose |#shortsfeed #youtubeshorts #shortsviral #short Chickpea salad recipe | Healthy salad for weightlose |#shortsfeed #youtubeshorts #shortsviral #short
    May 1, 2026
    Grilled chicken salad /Healthy food recipes/salad recipes Grilled chicken salad /Healthy food recipes/salad recipes
    May 1, 2026
    Healthy Sprouts Salad Recipe | @RanjusKitchen1984 #shorts Healthy Sprouts Salad Recipe | @RanjusKitchen1984 #shorts
    May 1, 2026
    cucumber salad #sisterskitchen #dailycooking #5mintrecipe #cucumber cucumber salad #sisterskitchen #dailycooking #5mintrecipe #cucumber
    May 1, 2026
    Previous Next
  • Bread
    Healthy Dahi Toast recipe | Dahi toast Recipe | Protein rich dahi toast | #shorts #viral #tasty Healthy Dahi Toast recipe | Dahi toast Recipe | Protein rich dahi toast | #shorts #viral #tasty
    May 1, 2026
    Bread New Breakfast Ideas #shorts #viralrecipe  #food #recipe Bread New Breakfast Ideas #shorts #viralrecipe #food #recipe
    May 1, 2026
    Easy Besan Bread Recipe | Perfect Healthy Snack & Breakfast Easy Besan Bread Recipe | Perfect Healthy Snack & Breakfast
    May 1, 2026
    Easy French Bread Breakfast! Cheesy Recipe #shorts Easy French Bread Breakfast! Cheesy Recipe #shorts
    April 30, 2026
    Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure Healthy No Bread Sandwich #shorts #ytshorts #healthybreakfast #nobreadsandwich #homefoodtreasure
    April 30, 2026
    Previous Next
  • Sandwich
    EASY & REFRESHING CUCUMBER SANDWICH | HEALTHY NO COOK RECIPE EASY & REFRESHING CUCUMBER SANDWICH | HEALTHY NO COOK RECIPE
    May 1, 2026
    Peanut banana toast | Healthy sandwich | quick recipes Peanut banana toast | Healthy sandwich | quick recipes
    May 1, 2026
    HEALTHY SANDWICH RECIPE|HIGH PROTEIN SANDWICH RECIPE| HeyAishu HEALTHY SANDWICH RECIPE|HIGH PROTEIN SANDWICH RECIPE| HeyAishu
    May 1, 2026
    Crispy Cheesy Corn Sandwich That's Actually Healthy #shorts #recipe #sandwich Crispy Cheesy Corn Sandwich That’s Actually Healthy #shorts #recipe #sandwich
    May 1, 2026
    Carrot Flatbread Instead of Bread! NoFlour, Air Fryer Carrot Flatbread Instead of Bread! NoFlour, Air Fryer
    April 30, 2026
    Previous Next
#masalapulao #masalariceincooker #ricerecipes #masalarice #healthyrecipes #friedricerecipe
Recipes

#masalapulao #masalariceincooker #ricerecipes #masalarice #healthyrecipes #friedricerecipe

By UCOOK June 3, 2025



#ricerecipes
#rice
#ricerecipe
#quickricerecipes
#easyricerecipe
#masalaricerecipe
#masalarice
#mixvegpulao
#masalapulaorecipe
#masalapulao
#onepotmeal
#onepotmealrecipe
#easymasalaricerecipe
#quickmasalaricerecipe
#curdricerecipe
#dinnerrecipe
#lunchrecipe
#homemadefood
#lunchboxrecipes
#ricedal
#healthyrecipes
#kadichawal
#rajmachawal

#BachelorsRecipe#Biryanirecipe#friedricerecipe#mixvegpulao#Onepotmeal#pulaorecipe#pulaorecipes#ricerecipesandabiryanirecipebengalipulaorecipebreakfastrecipeCuisinedinnerrecipeeasymasalaricerecipeeggbiryanirecipehealthyHealthy Cuisinehealthy recipeshealthycookinghealthylifestylehealthylivinghealthyrecipeskashmiripulaokashmiripulaorecipekheerrecipeslunchrecipemasalapulaomasalapulaorecipemasalapulaorecipesmasalaricemasalariceincookermixedvegpulaopulaopulaoandraitapunjabipulaorecipequickmasalaricereciperecipericericechapatiricekheerrecipericerecipevegpulaovegpulaorecipesVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.