UCOOK: Healthy Ideas
  • Recipes
    “Oil-Free Dahi Bhalla | Guilt-Free Holi Special Recipe | Instant &  Without Frying | Soft & Fluffy” “Oil-Free Dahi Bhalla | Guilt-Free Holi Special Recipe | Instant & Without Frying | Soft & Fluffy”
    March 2, 2026
    Healthy smooth drink for Iftaar recipe || #ramadan #energydrink #shortfood Healthy smooth drink for Iftaar recipe || #ramadan #energydrink #shortfood
    March 2, 2026
    Healthy veg vegetable fry rice recipe #shorts #youtubeshorts #recipe #vegtables #fryrice #viralshort Healthy veg vegetable fry rice recipe #shorts #youtubeshorts #recipe #vegtables #fryrice #viralshort
    March 1, 2026
    Garlic Parm Chicken Pasta High Protein Meal Prep Recipe #shorts Garlic Parm Chicken Pasta High Protein Meal Prep Recipe #shorts
    March 1, 2026
    Check bio for protein recipe ebook #caloriedeficit #highprotein #lowcarb #healthyrecipes #EasyRecipe Check bio for protein recipe ebook #caloriedeficit #highprotein #lowcarb #healthyrecipes #EasyRecipe
    March 1, 2026
    Previous Next
  • Breakfast
    Methi paratha | winter special methi paratha | Easy & healthy breakfast | crispy Fenugreek paratha Methi paratha | winter special methi paratha | Easy & healthy breakfast | crispy Fenugreek paratha
    March 2, 2026
    Quick Morning Breakfast with Egg & Banana | New Recipe #shorts #breakfastrecipe Quick Morning Breakfast with Egg & Banana | New Recipe #shorts #breakfastrecipe
    March 2, 2026
    Helathy ah oru breakfast seiyalama nga | ragi adai | ragi rotti | murungai rotti #shorts #breakfast Helathy ah oru breakfast seiyalama nga | ragi adai | ragi rotti | murungai rotti #shorts #breakfast
    March 2, 2026
    Poha Suji Vegetable Balls l Healthy Breakfast Recipe l Vegetable Poha Suji Balls Poha Suji Vegetable Balls l Healthy Breakfast Recipe l Vegetable Poha Suji Balls
    March 2, 2026
    Hare Matar Aur Suji ka Nashta | Healthy & Tasty Breakfast Recipe #shorts#cooking #Shraddha Ki Rasoi Hare Matar Aur Suji ka Nashta | Healthy & Tasty Breakfast Recipe #shorts#cooking #Shraddha Ki Rasoi
    March 1, 2026
    Previous Next
  • Lunch
    benefitssoakgram#recipe#health#food#shorts #healthtips #ayurved #ytshorts benefitssoakgram#recipe#health#food#shorts #healthtips #ayurved #ytshorts
    March 2, 2026
    #shorts #cake #healthy #recipe #food #shorts #cake #healthy #recipe #food
    March 2, 2026
    healthy uttapam recipe#food #recipe healthy uttapam recipe#food #recipe
    March 2, 2026
    Benefits chia seeds by Dr Sonia Narang #food  #health #recipe #shortsfeed #ytshorts Benefits chia seeds by Dr Sonia Narang #food #health #recipe #shortsfeed #ytshorts
    March 2, 2026
    Egg & Oatmeal Porridge: Quick & Healthy Breakfast Idea for Busy Mornings Egg & Oatmeal Porridge: Quick & Healthy Breakfast Idea for Busy Mornings
    March 2, 2026
    Previous Next
  • Dinner
    5 Minutes Healthy Breakfast Recipes | Wheat Flour Dosa | Breakfast & Dinner Recipes | easy recipes 5 Minutes Healthy Breakfast Recipes | Wheat Flour Dosa | Breakfast & Dinner Recipes | easy recipes
    March 2, 2026
    healthy dinner ideas for weight loss #food #shorts #health #soybean #sleep #subscribe #like #share healthy dinner ideas for weight loss #food #shorts #health #soybean #sleep #subscribe #like #share
    March 2, 2026
    Simple Healthy Dinner! Simple Healthy Dinner!
    March 1, 2026
    What I Eat in a Day While Working Full Time as a Mom of 4! Healthy Meal Prep Ideas on the Go! What I Eat in a Day While Working Full Time as a Mom of 4! Healthy Meal Prep Ideas on the Go!
    March 1, 2026
    kacchi haldi khane ke fayde#recipe#health#food#shorts kacchi haldi khane ke fayde#recipe#health#food#shorts
    March 1, 2026
    Previous Next
  • Snacks
    Banana Bread | Ragi Flour Bread | Ragi Banana Bread | Healthy Snack Recipe | Kids School Snack Idea. Banana Bread | Ragi Flour Bread | Ragi Banana Bread | Healthy Snack Recipe | Kids School Snack Idea.
    March 1, 2026
    crunchy pakoda recipe#snacks #pkode 1 March 2026 crunchy pakoda recipe#snacks #pkode 1 March 2026
    March 1, 2026
    Fruits transformation into healthy choco snacks #healthysnacks #fruitsstories @KoshKitchen Fruits transformation into healthy choco snacks #healthysnacks #fruitsstories @KoshKitchen
    March 1, 2026
    Viral Aalu Palak Balls #youtubeshorts #palak #aloo #snacksrecipe #snacks #shorts #shortsfeed #viral Viral Aalu Palak Balls #youtubeshorts #palak #aloo #snacksrecipe #snacks #shorts #shortsfeed #viral
    March 1, 2026
    Healthy snacks recipes for babies and toddler #7monthsbaby #baby #babyfood #snacks #healthy #cooking Healthy snacks recipes for babies and toddler #7monthsbaby #baby #babyfood #snacks #healthy #cooking
    March 1, 2026
    Previous Next
  • Weight Loss
    Drink This Green Juice to Support Weight Loss | Healthy Juice Recipe Drink This Green Juice to Support Weight Loss | Healthy Juice Recipe
    March 1, 2026
    Day 11 Ramadan Fatloss Challenge #ramadanweightloss #ramadandietplan #ramadan Day 11 Ramadan Fatloss Challenge #ramadanweightloss #ramadandietplan #ramadan
    March 1, 2026
    #day 8/30 weight lose challenge #viral shorts #trending shorts #day 8/30 weight lose challenge #viral shorts #trending shorts
    March 1, 2026
    Roasted Makhana #shorts #shortsfeed #recipe #odia #makhana #healthy #weightloss #easyrecipe#ytshorts Roasted Makhana #shorts #shortsfeed #recipe #odia #makhana #healthy #weightloss #easyrecipe#ytshorts
    March 1, 2026
    Frothy ICE-CREAM Coffee Recipe #shorts #coffee #spiceupflavourskitchen Frothy ICE-CREAM Coffee Recipe #shorts #coffee #spiceupflavourskitchen
    March 1, 2026
    Previous Next
  • Low Calorie
    Oats & Poha Namkeen | Easy Guilt Free Snack #shorts #recipe #namkeen #holisnacks #holirecipe Oats & Poha Namkeen | Easy Guilt Free Snack #shorts #recipe #namkeen #holisnacks #holirecipe
    March 2, 2026
    4 INGREDIENTS, HIGH PROTEIN, LOW CALORIE & ZERO FAT - Easy, Quick, Creamy, Healthy & Delicious 4 INGREDIENTS, HIGH PROTEIN, LOW CALORIE & ZERO FAT – Easy, Quick, Creamy, Healthy & Delicious
    March 1, 2026
    Saas Bahu Ka Kitchen  is live Saas Bahu Ka Kitchen is live
    March 1, 2026
    5 Unexpected Ways I Use Silken Tofu (Creamy, High-Protein & Low-Calorie!) 5 Unexpected Ways I Use Silken Tofu (Creamy, High-Protein & Low-Calorie!)
    March 1, 2026
    Zero oil salad recipe |Loose weight with taste #trending #shortsfeed #viral #ytshorts #video #food Zero oil salad recipe |Loose weight with taste #trending #shortsfeed #viral #ytshorts #video #food
    March 1, 2026
    Previous Next
  • Salad
    Put Italian Black Radish in and claim your health benefit. Put Italian Black Radish in and claim your health benefit.
    March 2, 2026
    Fresh Edamame Salad with Cucumber & Tomato #food Fresh Edamame Salad with Cucumber & Tomato #food
    March 2, 2026
    Healthy Paneer Salad Bowl Recipe | Breakfast Ideas | Fitness motivation | Wellness tips Healthy Paneer Salad Bowl Recipe | Breakfast Ideas | Fitness motivation | Wellness tips
    March 2, 2026
    5-minute tuna salad that's actually healthy #breakfast #recipe #healthy 5-minute tuna salad that’s actually healthy #breakfast #recipe #healthy
    March 1, 2026
    High Protein Salad Recipe (Whole Grains And Vegetables Healthy Salad High Protein Salad Recipe (Whole Grains And Vegetables Healthy Salad
    March 1, 2026
    Previous Next
  • Bread
    #voiceacting #voiceacting
    March 2, 2026
    Roti #roti #shortsfeed #food #shorts #viral #trend #cooking Roti #roti #shortsfeed #food #shorts #viral #trend #cooking
    March 2, 2026
    Lentil Bread Recipe | No Flour & High Protein! #lentils #highprotein #glutenfree #weightloss #shorts Lentil Bread Recipe | No Flour & High Protein! #lentils #highprotein #glutenfree #weightloss #shorts
    March 1, 2026
    No Yeast, No Flour! 2 Ingredient Cottage Cheese Bread No Yeast, No Flour! 2 Ingredient Cottage Cheese Bread
    March 1, 2026
    #shorts#youtubeshorts#subscribe#nirudirasooi#tost#banana#breadsnacks#healthy#desert#keepsupporting #shorts#youtubeshorts#subscribe#nirudirasooi#tost#banana#breadsnacks#healthy#desert#keepsupporting
    March 1, 2026
    Previous Next
  • Sandwich
    5 Minutes Recipe  |Quick And Easy Recipe  |Ramzan Special Recipe  |Crispy Potato sandwich 5 Minutes Recipe |Quick And Easy Recipe |Ramzan Special Recipe |Crispy Potato sandwich
    March 2, 2026
    No Bread Healthy protein Rich Sandwich #youtubeshorts #ytshorts No Bread Healthy protein Rich Sandwich #youtubeshorts #ytshorts
    March 2, 2026
    10 Min High Protein Meal #short #shortsfeed #easyrecipe #shots 10 Min High Protein Meal #short #shortsfeed #easyrecipe #shots
    March 2, 2026
    Healthy bread sandwich pizza easy recipe for Ramzan Healthy bread sandwich pizza easy recipe for Ramzan
    March 1, 2026
    Crispy Rava Sandwich | Perfect Tiffin Recipe#realdietseries #ytshorts #ytviral #viralshorts #shorts Crispy Rava Sandwich | Perfect Tiffin Recipe#realdietseries #ytshorts #ytviral #viralshorts #shorts
    March 1, 2026
    Previous Next
Vegetable Steamed Egg Recipe |  Healthy and Tasty | Mehek Delicious Dishes
Lunch

Vegetable Steamed Egg Recipe | Healthy and Tasty | Mehek Delicious Dishes

By UCOOK June 27, 2020

Short video on how to make vegetable steamed egg recipe.

CuisinedeliciousdishesegghealthyHealthy CuisineHealthy IdeasHealthy Lunchhealthy lunch ideasHealthy Lunch Recipeshealthy recipesideaslunchlunch ideasmehekrecipesteamedtastyvegetableVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.