UCOOK: Healthy Ideas
  • Recipes
    Suji aur Dahi se Banaye Soft and Healthy Breakfast #healthybreakfast #ytshorts #recipe #sujidhokla Suji aur Dahi se Banaye Soft and Healthy Breakfast #healthybreakfast #ytshorts #recipe #sujidhokla
    April 30, 2026
    Healthy And Tasty kulfi Ice Cream #icecream #food #foodie #foodshorts #telugushorts #tastyfood Healthy And Tasty kulfi Ice Cream #icecream #food #foodie #foodshorts #telugushorts #tastyfood
    April 30, 2026
    Viral Healthy tomato maggie #short #maggie #healthy #easyrecipe #maggi Viral Healthy tomato maggie #short #maggie #healthy #easyrecipe #maggi
    April 30, 2026
    5-Min Instant Mooli Pickle | (Pickled Radish)  #shorts #thecha #healthyrecipes #instantachaar 5-Min Instant Mooli Pickle | (Pickled Radish) #shorts #thecha #healthyrecipes #instantachaar
    April 30, 2026
    Kovakkai Poriyal | Tasty & Healthy recipes  #auslinhealthybites Kovakkai Poriyal | Tasty & Healthy recipes #auslinhealthybites
    April 29, 2026
    Previous Next
  • Breakfast
    Quick and Healthy Breakfast Ideas | Kids Lunch Box | Tiffin Recipes | Breakfast Recipe | Breakfast Quick and Healthy Breakfast Ideas | Kids Lunch Box | Tiffin Recipes | Breakfast Recipe | Breakfast
    April 30, 2026
    10 Minutes Instant Breakfast Recipes #shorts #shortvideo #youtubeshorts #ytshorts 10 Minutes Instant Breakfast Recipes #shorts #shortvideo #youtubeshorts #ytshorts
    April 30, 2026
    healthy breakfast ideas over night otas recipe #shorts#trending #food #healthy #otas healthy breakfast ideas over night otas recipe #shorts#trending #food #healthy #otas
    April 30, 2026
    Perfect Soft Idli Recipe | Healthy Breakfast in 10 Min idly Chutney #trending #viral #shortsfeed Perfect Soft Idli Recipe | Healthy Breakfast in 10 Min idly Chutney #trending #viral #shortsfeed
    April 30, 2026
    Tasty & Healthy Mushroom Macaroni Breakfast Recipe Tasty & Healthy Mushroom Macaroni Breakfast Recipe
    April 30, 2026
    Previous Next
  • Lunch
    Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts Healthy Lunch Combo for kids #healthylifestyle #lunchbox #recipe #health #shorts
    April 30, 2026
    Chicken Caesar Salad Wrap | Easy & Healthy Lunch Recipe Chicken Caesar Salad Wrap | Easy & Healthy Lunch Recipe
    April 30, 2026
    Mango Pudding #shorts #recipe #viral #viralshort #viralvideo #cooking #kitchen #healthy #food #yt Mango Pudding #shorts #recipe #viral #viralshort #viralvideo #cooking #kitchen #healthy #food #yt
    April 30, 2026
    Day 03 - Healthy Lunch Ideas | Indian Lunch Thali #healthylunch #balancedmeals #highproteinmeals Day 03 – Healthy Lunch Ideas | Indian Lunch Thali #healthylunch #balancedmeals #highproteinmeals
    April 30, 2026
    Kurangi gula pasir, tepung dan nasi putih #defisitkalori #menudietharian #shorts Kurangi gula pasir, tepung dan nasi putih #defisitkalori #menudietharian #shorts
    April 30, 2026
    Previous Next
  • Dinner
    #quickrecipe #breakfast #easyrecipe #food #love #explore #indian #shorts #quickrecipe #breakfast #easyrecipe #food #love #explore #indian #shorts
    April 30, 2026
    Dr Subhash Goyal’s SECRET Benefits of Moong Dal | Protein Moong Dal Recipe! #shorts Dr Subhash Goyal’s SECRET Benefits of Moong Dal | Protein Moong Dal Recipe! #shorts
    April 30, 2026
    Body Cooling Drink for Summer| Healthy Desi Drink#foodie#food #foodshorts#recipe #cooking#easyrecipe Body Cooling Drink for Summer| Healthy Desi Drink#foodie#food #foodshorts#recipe #cooking#easyrecipe
    April 30, 2026
    Ground beef filling #groundbeefrecipe  #mexicanfood #healthy #cooking #lowcalorie #highprotein #fyp Ground beef filling #groundbeefrecipe #mexicanfood #healthy #cooking #lowcalorie #highprotein #fyp
    April 29, 2026
    weekend VLOG: mental health chat, my glute workout, healthy dinner recipes + updated spring makeup weekend VLOG: mental health chat, my glute workout, healthy dinner recipes + updated spring makeup
    April 29, 2026
    Previous Next
  • Snacks
    #trending #viralshort#viralshorts #roastedchana #protinshake#healthy #healthymilk #trending #viralshort#viralshorts #roastedchana #protinshake#healthy #healthymilk
    April 30, 2026
    Healthy & Easy Recipe | Crispy Thalipeeth | #shorts #shortfeed  #viral  #recipe #food #healthy Healthy & Easy Recipe | Crispy Thalipeeth | #shorts #shortfeed #viral #recipe #food #healthy
    April 30, 2026
    Jhal Muri recipe ...#kitchen#cooking#shorts#healthy#snacks#recipe ..! Jhal Muri recipe …#kitchen#cooking#shorts#healthy#snacks#recipe ..!
    April 29, 2026
    Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice
    April 29, 2026
    today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral
    April 29, 2026
    Previous Next
  • Weight Loss
    Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending Ragi Smoothie Recipe for Strong Bones | Rich Calcium Iron Protein smoothie recipe #shorts #trending
    April 30, 2026
    Stop Cooking, Start Eating! (Raw Moong Salad)#Shorts #Foodie #HealthyRecipes Stop Cooking, Start Eating! (Raw Moong Salad)#Shorts #Foodie #HealthyRecipes
    April 30, 2026
    HelloFresh vs Factor 75 | Best for Weight Loss, Muscle Gain, and Healthy Living in 2026 HelloFresh vs Factor 75 | Best for Weight Loss, Muscle Gain, and Healthy Living in 2026
    April 30, 2026
    healthy breakfast and lunch recipes #vizagvlogs #food #cooking healthy breakfast and lunch recipes #vizagvlogs #food #cooking
    April 30, 2026
    This was bussin #explore #yogurtbowl #healthy #weightloss This was bussin #explore #yogurtbowl #healthy #weightloss
    April 30, 2026
    Previous Next
  • Low Calorie
    #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip #pesarapappu #pesarattu #healthybreakfast #summerfood #weightlossrecipes #southindianfood #healthtip
    April 30, 2026
    Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt! Weight Loss Sprouts Pizza | High Protein Low Calorie Healthy Recipe | No Maida No Guilt!
    April 30, 2026
    Quick and Easy Breakfast Recipes | Healthy Kids Tiffin Box Ideas | Lunch Box Recipes | Soft & Tasty Quick and Easy Breakfast Recipes | Healthy Kids Tiffin Box Ideas | Lunch Box Recipes | Soft & Tasty
    April 30, 2026
    High Fiber Low Calorie Breakfast Recipe  #fatloss High Fiber Low Calorie Breakfast Recipe #fatloss
    April 30, 2026
    Low Calorie Rice Bowl for Weight Loss |High Protein Healthy Recipe@SnehalsDiaries #weightlossmeal Low Calorie Rice Bowl for Weight Loss |High Protein Healthy Recipe@SnehalsDiaries #weightlossmeal
    April 30, 2026
    Previous Next
  • Salad
    Raw Mango Salad Recipe | Healthy & Refreshing Summer Salad | Tangy, Crunchy & Healthy Dish Raw Mango Salad Recipe | Healthy & Refreshing Summer Salad | Tangy, Crunchy & Healthy Dish
    April 30, 2026
    Perfect Lunchbox Idea Yeh Creamy Pasta Salad #shorts #healthy #easyrecipe Perfect Lunchbox Idea Yeh Creamy Pasta Salad #shorts #healthy #easyrecipe
    April 30, 2026
    High Protein Chickpeas Salad Recipe | #shorts #foodshorts #shortsfeed High Protein Chickpeas Salad Recipe | #shorts #foodshorts #shortsfeed
    April 30, 2026
    Mix Creamy Salad Recipe By Maria Ansari | Yummy Healthy Salad | Weight Loss Summer Salad | Mix Creamy Salad Recipe By Maria Ansari | Yummy Healthy Salad | Weight Loss Summer Salad |
    April 30, 2026
    Chicken and beetroot salad / healthy salad recipe /salad recipes#healthylifestyle #salad Chicken and beetroot salad / healthy salad recipe /salad recipes#healthylifestyle #salad
    April 29, 2026
    Previous Next
  • Bread
    Healthy Dahi bread toast recipe at home | High Protein Dahi Toast | Easy to make dahi toast #shorts Healthy Dahi bread toast recipe at home | High Protein Dahi Toast | Easy to make dahi toast #shorts
    April 30, 2026
    Cheesy Besan Toast | Healthy Breakfast Recipe #breakfast #trending #shorts #food Cheesy Besan Toast | Healthy Breakfast Recipe #breakfast #trending #shorts #food
    April 30, 2026
    Zero Carbs & Flourless: 2-Ingredient High-Protein Bread (Fluffy, Easy & Delicious!) Zero Carbs & Flourless: 2-Ingredient High-Protein Bread (Fluffy, Easy & Delicious!)
    April 30, 2026
    High Protein Bread Puffs Recipe | No frying No Maida | 10g per puff High Protein Bread Puffs Recipe | No frying No Maida | 10g per puff
    April 30, 2026
    Healthy Banana Bread Recipe! #healthylifestyle #healthydessertrecipe #bananabreadrecipe #dessert Healthy Banana Bread Recipe! #healthylifestyle #healthydessertrecipe #bananabreadrecipe #dessert
    April 30, 2026
    Previous Next
  • Sandwich
    Honey Banana Sandwich Recipe | Easy Breakfast Recipe |  instant Breakfast Recipe Honey Banana Sandwich Recipe | Easy Breakfast Recipe | instant Breakfast Recipe
    April 30, 2026
    Protein sandwich #food #recipe #cooking #reels #foodie #love #relationship #fyp #babifreitas #shorts Protein sandwich #food #recipe #cooking #reels #foodie #love #relationship #fyp #babifreitas #shorts
    April 30, 2026
    Healthy mayonnaise sandwich #lunchboxrecipes #lunchbox #homemademayonnaiserecipe #shorts #shortsfeed Healthy mayonnaise sandwich #lunchboxrecipes #lunchbox #homemademayonnaiserecipe #shorts #shortsfeed
    April 30, 2026
    grill sandwich recipe #healthy sandwich for weight loss recipe #shorts grill sandwich recipe #healthy sandwich for weight loss recipe #shorts
    April 30, 2026
    Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs
    April 29, 2026
    Previous Next
How to make a healthy salad | Sprouted green gram salad with Mustard microgreens  #shorts  #magudi
Salad

How to make a healthy salad | Sprouted green gram salad with Mustard microgreens #shorts #magudi

By UCOOK February 17, 2023

Foxtail millet with purple sweet potato powder puttu –
#healthylifestyle #ytshorts #trending #diy #shorts

#farmshop#fingermillet#milletsfarm#milletsfarmcentre#milletsnacks#ragibenefitsamazonproductBreakfastbreakfastrecipecookingCOVIDCuisineeasytomakesaladeathealthyFarmFLOWERSfoodfoodbloggerfoodiefoodphotographyfoodpornGogreenGramGreenGreengramhealthyHealthy CuisineHealthy Ideashealthy recipeshealthy saladHealthy Salad IdeasHealthy Salad RecipeshealthycookinghealthylifestylehealthylivinghealthyrecipeshomemadehowtomakesaladideasindianfoodmagudiMicrogreensmilletsmilletsfoodsMustardnutritionorganicrecipesaladSalad Ideassalad recipessaladmakingshortssorghumsouthindianfoodSproutedstayfitsupportlocalveganVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.