UCOOK: Healthy Ideas
  • Recipes
    "It is good to eat when you feel hungry"/#healthtips  #shorts #healthy #healthyrecipes #shortsfeed “It is good to eat when you feel hungry”/#healthtips #shorts #healthy #healthyrecipes #shortsfeed
    February 2, 2026
    Healthy masur dal utthappa #healthy recipes #utthappa Healthy masur dal utthappa #healthy recipes #utthappa
    February 2, 2026
    Beetroot paratha recipe |healthy recipes |aloo methi paratha |#ytshorts #shorts #trending #viral Beetroot paratha recipe |healthy recipes |aloo methi paratha |#ytshorts #shorts #trending #viral
    February 2, 2026
    Cottage Cheese Alfredo #cottagecheeserecipes #healthyrecipes #girldinner Cottage Cheese Alfredo #cottagecheeserecipes #healthyrecipes #girldinner
    February 1, 2026
    Egg White Omelet | Healthy Recipes for Weight Loss | High Protein Foods | Diet Plan for Weight Loss Egg White Omelet | Healthy Recipes for Weight Loss | High Protein Foods | Diet Plan for Weight Loss
    February 1, 2026
    Previous Next
  • Breakfast
    Healthy Breakfast Recipe south indian style #foryou #shorts Healthy Breakfast Recipe south indian style #foryou #shorts
    February 2, 2026
    Morning Healthy Breakfast #chilla #healthy #shortsfeed #recipe #shortvideo #easyrecipe #shorts #food Morning Healthy Breakfast #chilla #healthy #shortsfeed #recipe #shortvideo #easyrecipe #shorts #food
    February 2, 2026
    Healthy Breakfast Ideas|Easy Breakfast Recipes #youtubeshorts #shorts#breakfast Healthy Breakfast Ideas|Easy Breakfast Recipes #youtubeshorts #shorts#breakfast
    February 2, 2026
    Day-20 healthy Breakfast series #dietbreakfast #diet #healthybreakfast #breakfastideas #cooking Day-20 healthy Breakfast series #dietbreakfast #diet #healthybreakfast #breakfastideas #cooking
    February 1, 2026
    No Junk!  Healthy Vegetarian Recipes | Protein Iron Breakfast | Perfect for School Tiffin Recipe No Junk! Healthy Vegetarian Recipes | Protein Iron Breakfast | Perfect for School Tiffin Recipe
    February 1, 2026
    Previous Next
  • Lunch
    healthy lunch menu #food #shortsfeed#foodie #comedy #cooking #lunch #lunchbox#funnydialogue #chicken healthy lunch menu #food #shortsfeed#foodie #comedy #cooking #lunch #lunchbox#funnydialogue #chicken
    February 2, 2026
    My Healthy Lunch Plate #healthyrecipe #lunchmenu #soyachunks #weightloss #shorts My Healthy Lunch Plate #healthyrecipe #lunchmenu #soyachunks #weightloss #shorts
    February 2, 2026
    Guava Cucumber Salad | High Fiber Weight Loss Salad | Healthy Lunch / Iftar Guava Cucumber Salad | High Fiber Weight Loss Salad | Healthy Lunch / Iftar
    February 2, 2026
    Healthy lunch #food #cooking #viral #villagerlifestyle #healthy #homemade #bhoji #lunchthali #yt Healthy lunch #food #cooking #viral #villagerlifestyle #healthy #homemade #bhoji #lunchthali #yt
    February 2, 2026
    Healthy Kids lunch box recipe|| viral short snacks recipes|| #kidslunchbox #healthybreakfast #shorts Healthy Kids lunch box recipe|| viral short snacks recipes|| #kidslunchbox #healthybreakfast #shorts
    February 2, 2026
    Previous Next
  • Dinner
    Healthy Veg Pulao Recipe: Acha Khao Acha khilao! #food #shorts #youtubeshorts Healthy Veg Pulao Recipe: Acha Khao Acha khilao! #food #shorts #youtubeshorts
    February 1, 2026
    Healthy Sri Lankan Red Rice Dinner with Spicy Fish Curry & Pol Sambol #shorts Healthy Sri Lankan Red Rice Dinner with Spicy Fish Curry & Pol Sambol #shorts
    February 1, 2026
    Broccoli Mushroom Stir Fry | Quick Healthy Veg Recipe | Easy Dinner Idea #shorts #ytshorts Broccoli Mushroom Stir Fry | Quick Healthy Veg Recipe | Easy Dinner Idea #shorts #ytshorts
    February 1, 2026
    Easy Kids Lunchbox Recipe | Tiffin Recipes | Lunch Box Recipes | Healthy Breakfast Recipes Indian Easy Kids Lunchbox Recipe | Tiffin Recipes | Lunch Box Recipes | Healthy Breakfast Recipes Indian
    February 1, 2026
    Healthy Ampalaya Leaves | Easy Meal Ideas | Kuya Tito Healthy Ampalaya Leaves | Easy Meal Ideas | Kuya Tito
    February 1, 2026
    Previous Next
  • Snacks
    Air Fryer+Matar Namkeen Crispy & Healthy Namkeen Ghar Par | Easy Recipe#shorts#@cookandfoods21# Air Fryer+Matar Namkeen Crispy & Healthy Namkeen Ghar Par | Easy Recipe#shorts#@cookandfoods21#
    February 2, 2026
    Healthy breakfast #healthy #breakfast #tiffin #snacks #recipe #cooking #homemade #veggies #shorts Healthy breakfast #healthy #breakfast #tiffin #snacks #recipe #cooking #homemade #veggies #shorts
    February 1, 2026
    Looking for a healthy snack? @chobani @bearnakedgranola #healthy #snacks #shorts #fyp #easyrecipe Looking for a healthy snack? @chobani @bearnakedgranola #healthy #snacks #shorts #fyp #easyrecipe
    February 1, 2026
    Soya chunk sandwich | #soyabean #sandwich #healthysnacks #shortsvideo Soya chunk sandwich | #soyabean #sandwich #healthysnacks #shortsvideo
    February 1, 2026
    I Stopped Buying These 5 “Healthy” Snacks (I Make Them Instead) I Stopped Buying These 5 “Healthy” Snacks (I Make Them Instead)
    February 1, 2026
    Previous Next
  • Weight Loss
    Healthy Weight Loss Iftar Recipe | Oil Free High Protein Kebabs | Ramadan Special Healthy Weight Loss Iftar Recipe | Oil Free High Protein Kebabs | Ramadan Special
    February 2, 2026
    Try Natures HAWAIIAN PUNCH!!!! #shorts #fruit #juice #asmr #weightloss #healthyrecipes Try Natures HAWAIIAN PUNCH!!!! #shorts #fruit #juice #asmr #weightloss #healthyrecipes
    January 31, 2026
    chia seeds Benefits with recipe | #shortsfeed | shorts #recipe #food chia seeds Benefits with recipe | #shortsfeed | shorts #recipe #food
    January 31, 2026
    #shortsHealthy Recipe #viral #ytshorts #healthy #shortsHealthy Recipe #viral #ytshorts #healthy
    January 31, 2026
    onion pakoda #crispypakoras #onionpakoda #weightlossrecipes onion pakoda #crispypakoras #onionpakoda #weightlossrecipes
    January 31, 2026
    Previous Next
  • Low Calorie
    Healthier Valentines Dip! #easyrecipe #healthyrecipes #healthyswaps #dessertideas #lowsugar Healthier Valentines Dip! #easyrecipe #healthyrecipes #healthyswaps #dessertideas #lowsugar
    February 2, 2026
    One-Pot Low-Calorie Meals - Easy & Healthy One-Pot Low-Calorie Meals – Easy & Healthy
    February 2, 2026
    Ep: 27/50 Healthy Bowls | 22g Protein | High Protein & Low Calorie | Zucchini Paneer Bowl Ep: 27/50 Healthy Bowls | 22g Protein | High Protein & Low Calorie | Zucchini Paneer Bowl
    February 2, 2026
    Low Calorie Chicken Tenders for Fat Loss (7 Flavors) Low Calorie Chicken Tenders for Fat Loss (7 Flavors)
    February 1, 2026
    EASIEST Meal Prep for a Family (fat loss friendly dinners everyone will eat) EASIEST Meal Prep for a Family (fat loss friendly dinners everyone will eat)
    February 1, 2026
    Previous Next
  • Salad
    High Protein Soya Salad | Weight Loss Recipe | Salad Dressings | Healthy Salad #youtubeshorts High Protein Soya Salad | Weight Loss Recipe | Salad Dressings | Healthy Salad #youtubeshorts
    February 1, 2026
    If you are over 50, this recipe is for you! Chickpea salad that burns belly fat! Healthy recipe! If you are over 50, this recipe is for you! Chickpea salad that burns belly fat! Healthy recipe!
    January 31, 2026
    Virat Kohli’s Fitness Reason | Protein salad quick recipe #healthyfood #nutritionchallenge #eatfit Virat Kohli’s Fitness Reason | Protein salad quick recipe #healthyfood #nutritionchallenge #eatfit
    January 31, 2026
    Only a few people know this CUCUMBER salad recipe| It’s a weight loss & perfect salad for you! Only a few people know this CUCUMBER salad recipe| It’s a weight loss & perfect salad for you!
    January 31, 2026
    Healthy Carrot Raisin Salad | Quick & Easy Sweet Salad Recipe | Gajar ka Salad Healthy Carrot Raisin Salad | Quick & Easy Sweet Salad Recipe | Gajar ka Salad
    January 31, 2026
    Previous Next
  • Bread
    Bread delight|Creamy dessert recipe|party|healthy dessert|bread recipes#dessert #bread#party#sweet Bread delight|Creamy dessert recipe|party|healthy dessert|bread recipes#dessert #bread#party#sweet
    February 2, 2026
    10 Minute Healthy Breakfast & Tiffin Special Recipe | Soft & Healthy Veg Paratha | 10 Minute Healthy Breakfast & Tiffin Special Recipe | Soft & Healthy Veg Paratha |
    February 1, 2026
    COTTAGE CHEESE MUG BREAD! 3 Recipes, No Flour, High Protein COTTAGE CHEESE MUG BREAD! 3 Recipes, No Flour, High Protein
    February 1, 2026
    Healthy Tiffin Recipe for Kids #shorts #youtubeshorts #trending #healthy Healthy Tiffin Recipe for Kids #shorts #youtubeshorts #trending #healthy
    February 1, 2026
    Milky bread toast recipe#trending recipe#viral shorts#cooking#food#health#recipe#breakfast# Milky bread toast recipe#trending recipe#viral shorts#cooking#food#health#recipe#breakfast#
    February 1, 2026
    Previous Next
  • Sandwich
    chesy sandwich recipe#shorts #recipe #sandwich #healthy @KabitasKitchen chesy sandwich recipe#shorts #recipe #sandwich #healthy @KabitasKitchen
    February 2, 2026
    Protein Rich Steamed Chicken Sandwich  @mayagarments  #shorts #reels #healthy #trending #viral Protein Rich Steamed Chicken Sandwich @mayagarments #shorts #reels #healthy #trending #viral
    February 2, 2026
    Easy Veg Sandwich Recipe | Healthy Sandwich at Home | Easy Snack #sandwich #recipe #trending #yt Easy Veg Sandwich Recipe | Healthy Sandwich at Home | Easy Snack #sandwich #recipe #trending #yt
    February 1, 2026
    Healthy Rajmah Kebab Sandwich  banane ki recipe | Protein Rich Veg Sub #recipe #shorts Healthy Rajmah Kebab Sandwich banane ki recipe | Protein Rich Veg Sub #recipe #shorts
    January 30, 2026
    Viral chicken Recipe | High Protein Recipe | Healthy Sandwich Recipe Viral chicken Recipe | High Protein Recipe | Healthy Sandwich Recipe
    January 30, 2026
    Previous Next
How to make a healthy salad | Sprouted green gram salad with Mustard microgreens  #shorts  #magudi
Salad

How to make a healthy salad | Sprouted green gram salad with Mustard microgreens #shorts #magudi

By UCOOK February 17, 2023

Foxtail millet with purple sweet potato powder puttu –
#healthylifestyle #ytshorts #trending #diy #shorts

#farmshop#fingermillet#milletsfarm#milletsfarmcentre#milletsnacks#ragibenefitsamazonproductBreakfastbreakfastrecipecookingCOVIDCuisineeasytomakesaladeathealthyFarmFLOWERSfoodfoodbloggerfoodiefoodphotographyfoodpornGogreenGramGreenGreengramhealthyHealthy CuisineHealthy Ideashealthy recipeshealthy saladHealthy Salad IdeasHealthy Salad RecipeshealthycookinghealthylifestylehealthylivinghealthyrecipeshomemadehowtomakesaladideasindianfoodmagudiMicrogreensmilletsmilletsfoodsMustardnutritionorganicrecipesaladSalad Ideassalad recipessaladmakingshortssorghumsouthindianfoodSproutedstayfitsupportlocalveganVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.