UCOOK: Healthy Ideas
  • Recipes
    Code ‘April’ saves you 10% on #Caraway #friendsofcaraway #mealprep #healthyrecipes Code ‘April’ saves you 10% on #Caraway #friendsofcaraway #mealprep #healthyrecipes
    April 23, 2026
    Ragi Malt Recipe | Healthy Morning Drink | Ragi Java in Telugu #shortsfeed #shorts #yt #ragi Ragi Malt Recipe | Healthy Morning Drink | Ragi Java in Telugu #shortsfeed #shorts #yt #ragi
    April 23, 2026
    Healthy Sweet Potato Chapathi for Kids | Soft & Easy No Maida Recipe | Lunchbox Idea Healthy Sweet Potato Chapathi for Kids | Soft & Easy No Maida Recipe | Lunchbox Idea
    April 23, 2026
    Soup Premix powder recipe | home making soup | for #weightloss #healthysoup   #sonaliscrazycravings Soup Premix powder recipe | home making soup | for #weightloss #healthysoup #sonaliscrazycravings
    April 23, 2026
    Sirf 30 Minute mein Banayein Pet Bharne wali Vrat ki Thali #healthyrecipes #recipe  #pureveg Sirf 30 Minute mein Banayein Pet Bharne wali Vrat ki Thali #healthyrecipes #recipe #pureveg
    April 23, 2026
    Previous Next
  • Breakfast
    Hot Honey Pizza Bites High Protein Low Calorie Snack Recipe #shorts Hot Honey Pizza Bites High Protein Low Calorie Snack Recipe #shorts
    April 23, 2026
    FRONTIER WESTERN | The Wilderness Road (OUTLAWS & SURVIVAL in brutal America, Film) FRONTIER WESTERN | The Wilderness Road (OUTLAWS & SURVIVAL in brutal America, Film)
    April 23, 2026
    Healthy Oats & Dry Fruits Shake Instant Healthy Breakfast Drink Protein Rich Breakfast No sugar#food Healthy Oats & Dry Fruits Shake Instant Healthy Breakfast Drink Protein Rich Breakfast No sugar#food
    April 23, 2026
    Easy Ricotta Toast with Chia Jam Breakfast Recipe Easy Ricotta Toast with Chia Jam Breakfast Recipe
    April 23, 2026
    Your Healthy Breakfast Is Lying to You Your Healthy Breakfast Is Lying to You
    April 23, 2026
    Previous Next
  • Lunch
    tasty and healthy lunch thali #bansalmomdiaries #cooking #trending tasty and healthy lunch thali #bansalmomdiaries #cooking #trending
    April 23, 2026
    First recipe video in a few months! Lots more healthy food... #Shorts #clairehodginss First recipe video in a few months! Lots more healthy food… #Shorts #clairehodginss
    April 23, 2026
    taco bell dupe hehe #rawvegan #carcamping #carliving #healthy taco bell dupe hehe #rawvegan #carcamping #carliving #healthy
    April 23, 2026
    Secrete Weight Loss Lunch ideas for Weight Loss #shorts #shortvideo #lunch #lunchboxideas Secrete Weight Loss Lunch ideas for Weight Loss #shorts #shortvideo #lunch #lunchboxideas
    April 23, 2026
    zero oil lunch idea/ healthy recipe for kids#cookwithnilofar #reelitfeelit #shortfeed #zerooillunch zero oil lunch idea/ healthy recipe for kids#cookwithnilofar #reelitfeelit #shortfeed #zerooillunch
    April 23, 2026
    Previous Next
  • Dinner
    #mealplan #dinnerideas #mealsimadethisweek #healthydinner #recipe #food #mealplan #dinnerideas #mealsimadethisweek #healthydinner #recipe #food
    April 23, 2026
    Day4 of healthy dinner”high protein soyabean curry”#easyrecipe #ytshorts #shorts #healthyfood Day4 of healthy dinner”high protein soyabean curry”#easyrecipe #ytshorts #shorts #healthyfood
    April 23, 2026
    Moong sprouts recipe #youtube #recipe #healthy #shortvideo #trendingrecipe #breakfast Moong sprouts recipe #youtube #recipe #healthy #shortvideo #trendingrecipe #breakfast
    April 23, 2026
    healthy dinner #youtubeshorts  #food  #viralvideo #recipe  #cooking healthy dinner #youtubeshorts #food #viralvideo #recipe #cooking
    April 23, 2026
    One pot Healthiest pav bhaji / full recipe in description / subscribe for healthy recipes One pot Healthiest pav bhaji / full recipe in description / subscribe for healthy recipes
    April 23, 2026
    Previous Next
  • Snacks
    Healthy snacks #food #cooking #recipe #youtubeshorts #fyp #ytshorts Healthy snacks #food #cooking #recipe #youtubeshorts #fyp #ytshorts
    April 23, 2026
    Moong Sprouts Paneer Manchurian| Healthy Snack #health #shorts #recipe Moong Sprouts Paneer Manchurian| Healthy Snack #health #shorts #recipe
    April 23, 2026
    healthy snacks restock  #shorts healthy snacks restock #shorts
    April 23, 2026
    High protein tikki chaat must try #viral #recipe #yt #food #healthyrecipes #weightlossrecipes High protein tikki chaat must try #viral #recipe #yt #food #healthyrecipes #weightlossrecipes
    April 23, 2026
    Chatpata Kala Chana Masala Chaat #shortsfeed #shortsvideo #shorts #recipe #cooking #chaat #protein Chatpata Kala Chana Masala Chaat #shortsfeed #shortsvideo #shorts #recipe #cooking #chaat #protein
    April 23, 2026
    Previous Next
  • Weight Loss
    healthy weight loss salad vegetable #food #recipe #lifeisbutadream #cooking 24 April 2026 healthy weight loss salad vegetable #food #recipe #lifeisbutadream #cooking 24 April 2026
    April 23, 2026
    Beetroot + Carrot Soup Recipe | Glowing Skin & Gut Health by Naima Apa #shorts #glowingskin #gut Beetroot + Carrot Soup Recipe | Glowing Skin & Gut Health by Naima Apa #shorts #glowingskin #gut
    April 23, 2026
    #johnabraham #healthy #diet #cooking #ytshorts #viralrecipe #chiapudding #Mangobanana pudding #johnabraham #healthy #diet #cooking #ytshorts #viralrecipe #chiapudding #Mangobanana pudding
    April 23, 2026
    Moonglet #food #cooking #recipe #breakfast Moonglet #food #cooking #recipe #breakfast
    April 23, 2026
    Healthy sabja seeds for fast weight loss#healthydrink#ytshorts#viral Healthy sabja seeds for fast weight loss#healthydrink#ytshorts#viral
    April 23, 2026
    Previous Next
  • Low Calorie
    High Protein + Low Calorie Edamame In Minutes #mealprep #healthyrecipes High Protein + Low Calorie Edamame In Minutes #mealprep #healthyrecipes
    April 23, 2026
    Herb-Spice makhana #makhana #makhanasnacks ##lowcalorie #proteinrich #dietfood #healthyfood #food Herb-Spice makhana #makhana #makhanasnacks ##lowcalorie #proteinrich #dietfood #healthyfood #food
    April 23, 2026
    Steamed Carrot Strips | 5-Minute Healthy & Low-Calorie Recipe Steamed Carrot Strips | 5-Minute Healthy & Low-Calorie Recipe
    April 23, 2026
    Healthy Mushroom Quiche with Lavash | Easy Low-Calorie Recipe Healthy Mushroom Quiche with Lavash | Easy Low-Calorie Recipe
    April 23, 2026
    Khati mirch recipe | instant achar recipe #shorts #food #chilies #pickle #ijazansarifoodsecrets Khati mirch recipe | instant achar recipe #shorts #food #chilies #pickle #ijazansarifoodsecrets
    April 23, 2026
    Previous Next
  • Salad
    5-Minute Easy Salad Recipe | Healthy Lunch Idea #saladrecipe 5-Minute Easy Salad Recipe | Healthy Lunch Idea #saladrecipe
    April 23, 2026
    Reject Normie Salad, Embrace Tabbouleh. (healthy recipe) Reject Normie Salad, Embrace Tabbouleh. (healthy recipe)
    April 23, 2026
    easy salad dressing||#shortsfeed easy salad dressing||#shortsfeed
    April 23, 2026
    Ultimate Creamy Crunch Chicken Salad | Easy & Delicious Chicken Salad Recipe #easyrecipes #recipe Ultimate Creamy Crunch Chicken Salad | Easy & Delicious Chicken Salad Recipe #easyrecipes #recipe
    April 23, 2026
    Healthy Fruit Salad in 2 Minute,#food ,#recipe ,#healthy ,#fyp ,#fruit ,#cooking,#salad . Healthy Fruit Salad in 2 Minute,#food ,#recipe ,#healthy ,#fyp ,#fruit ,#cooking,#salad .
    April 23, 2026
    Previous Next
  • Bread
    BREAD UPMA #bread #upma #cooking BREAD UPMA #bread #upma #cooking
    April 23, 2026
    Who Said Healthy Food Can’t Be Delicious (High Protein Scones) Who Said Healthy Food Can’t Be Delicious (High Protein Scones)
    April 23, 2026
    Khoya Kulfi | Mawa Kulfi #shorts #khoyakulfi #malaikulfi #kulfi #recipe #trendingshorts #mawakulfi Khoya Kulfi | Mawa Kulfi #shorts #khoyakulfi #malaikulfi #kulfi #recipe #trendingshorts #mawakulfi
    April 23, 2026
    “Homemade Whole Wheat Bread | Easy & Tasty”#shorts #shortsfeed #baking #wholewheatbread #recipe “Homemade Whole Wheat Bread | Easy & Tasty”#shorts #shortsfeed #baking #wholewheatbread #recipe
    April 23, 2026
    kids Healthy Breakfast#Healthy bread chart recipe#viral #trending #healthy food#Yt shorts kids Healthy Breakfast#Healthy bread chart recipe#viral #trending #healthy food#Yt shorts
    April 23, 2026
    Previous Next
  • Sandwich
    35g Protein Tuna Pita in 5 Minutes (No Mayo) 35g Protein Tuna Pita in 5 Minutes (No Mayo)
    April 23, 2026
    Crispy Avocado Egg Sandwich Recipe | Viral Breakfast Toast Crispy Avocado Egg Sandwich Recipe | Viral Breakfast Toast
    April 23, 2026
    Easy and Delicious Airfyer Fajitas! Yum & Done Recipes Easy and Delicious Airfyer Fajitas! Yum & Done Recipes
    April 23, 2026
    High Protein Veg Hung Curd Sandwich| Dahi Sandwich| Healthy Kids Lunch Box Recipe @monifoody High Protein Veg Hung Curd Sandwich| Dahi Sandwich| Healthy Kids Lunch Box Recipe @monifoody
    April 23, 2026
    Kids Tiffin Box Recipe | Sandwich for kids #shorts #tiffin #kidstiffinrecipe #sandwich Kids Tiffin Box Recipe | Sandwich for kids #shorts #tiffin #kidstiffinrecipe #sandwich
    April 23, 2026
    Previous Next
Wholesome & Fast: Low-Calorie Recipes Made Simple
Low Calorie

Wholesome & Fast: Low-Calorie Recipes Made Simple

By UCOOK June 22, 2025

#EasyCleanEating#FastHealthyMeals#healthyanddelicious#lightmeals#LowCalComfortFood#lowcalorierecipes#mealprepideas#NutritiousAndEasy#quickdinnerideas#QuickHealthyRecipes#SmartEating#wholesomemealsbalancedeatingCuisineeasyhealthymealsfastfitfoodhealthyHealthy CuisineHealthy IdeasHealthy Low CalorieHealthy Low Calorie IdeasHealthy Low Calorie Recipeshealthy recipeshealthychoiceshealthyeatinghealthyfoodideashealthylifestylehealthylivinghealthyrecipeshealthysnackideasideaslow calorieLow Calorie IdeasLow Calorie RecipesLowCalorieLowCalorieCookinglowcaloriemealnourishyourbodyquickandeasymealsreciperecipessimplesimplehealthyrecipesUNDER300CALORIESVideoVlogweightlossmealsWholesomeYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.