UCOOK: Healthy Ideas
  • Recipes
    garlic thokku recipe tasty healthy samyal happy cooking #food #healthyfood garlic thokku recipe tasty healthy samyal happy cooking #food #healthyfood
    January 29, 2026
    HIGH PROTEIN COOKIE DOUGH #highprotein #healthyrecipes #yummyrecipe HIGH PROTEIN COOKIE DOUGH #highprotein #healthyrecipes #yummyrecipe
    January 28, 2026
    Moringa Paratha| Healthiest Food #recipe #shortsviral #shorts #food #healthy #paratha PM Modi Recipe Moringa Paratha| Healthiest Food #recipe #shortsviral #shorts #food #healthy #paratha PM Modi Recipe
    January 28, 2026
    Bihar Ka Swad Winter Special Chana Bathua Saag Recipe #shorts #shortsfeed #healthy Bihar Ka Swad Winter Special Chana Bathua Saag Recipe #shorts #shortsfeed #healthy
    January 28, 2026
    wheat flour coconut cookies #easy recipe #shortsfeed #shortviral #healthy recipes wheat flour coconut cookies #easy recipe #shortsfeed #shortviral #healthy recipes
    January 28, 2026
    Previous Next
  • Breakfast
    High protein Shrot viral easy breakfast recipes|| weight loss #kidslunchbox #healthybreakfast High protein Shrot viral easy breakfast recipes|| weight loss #kidslunchbox #healthybreakfast
    January 29, 2026
    Indori Poha Recipe |Steamed Poha Recipe | Healthy Breakfast Recipe #shorts #youtubeshorts Indori Poha Recipe |Steamed Poha Recipe | Healthy Breakfast Recipe #shorts #youtubeshorts
    January 29, 2026
    Try This! 10-Minute High-Protein Veg Breakfast Recipes |  Healthy Protine- rich Tiffin Recipes Try This! 10-Minute High-Protein Veg Breakfast Recipes | Healthy Protine- rich Tiffin Recipes
    January 29, 2026
    Only 5 Minutes Healthy And Tasty Breakfast Recipes | New Nasta Recipe Only 5 Minutes Healthy And Tasty Breakfast Recipes | New Nasta Recipe
    January 29, 2026
    Healthy Breakfast #new #kannada #kannadafood #vegsalad #salad #protiensalad #morningbreakfast #short Healthy Breakfast #new #kannada #kannadafood #vegsalad #salad #protiensalad #morningbreakfast #short
    January 29, 2026
    Previous Next
  • Lunch
    #masala rice recipe #healthy lunch recipe #healthy dinner #weightloss #quick rice recipe #masalebhat #masala rice recipe #healthy lunch recipe #healthy dinner #weightloss #quick rice recipe #masalebhat
    January 29, 2026
    29 January ki Lunch Thali #food #foodshorts #lunch #shorts #trending #viral #ytshorts 29 January ki Lunch Thali #food #foodshorts #lunch #shorts #trending #viral #ytshorts
    January 29, 2026
    Healthy Lunch Menu #lunchideas #lunchmenu #lunch #foodshorts #food #shorts Healthy Lunch Menu #lunchideas #lunchmenu #lunch #foodshorts #food #shorts
    January 29, 2026
    healthy lunch ideas healthy lunch ideas
    January 29, 2026
    Healthy Lunch Ideas for Toddlers Soft & Nutritious #toddlersfood#healthylunch#kidsmealideas#homemade Healthy Lunch Ideas for Toddlers Soft & Nutritious #toddlersfood#healthylunch#kidsmealideas#homemade
    January 29, 2026
    Previous Next
  • Dinner
    Healthy dinner recipes ideas for kids #healthyfood #healthyfood #kidsfoodrecipes #food #cooking Healthy dinner recipes ideas for kids #healthyfood #healthyfood #kidsfoodrecipes #food #cooking
    January 29, 2026
    healthy peanut sauce noodles!!! Yummy dinner in under 20 mins ;) #healthydinner #simplerecipe #yum healthy peanut sauce noodles!!! Yummy dinner in under 20 mins ;) #healthydinner #simplerecipe #yum
    January 28, 2026
    3 High Protein Dinner Recipes |Healthy Comfort Food for Weight Loss 3 High Protein Dinner Recipes |Healthy Comfort Food for Weight Loss
    January 28, 2026
    Easy Healthy Dinner Ideas for Busy Nights #bodysignals #health #food  #shorts #skincare #weightloss Easy Healthy Dinner Ideas for Busy Nights #bodysignals #health #food #shorts #skincare #weightloss
    January 27, 2026
    Easy Healthy Dinner Ideas for Busy Nights #bodysignals #health #food  #shorts #skincare #weightloss Easy Healthy Dinner Ideas for Busy Nights #bodysignals #health #food #shorts #skincare #weightloss
    January 27, 2026
    Previous Next
  • Snacks
    Corn Chat | Healthy Corn Chat Recipe.#corn #cornchaatrecipe #cornsnacks #cornrecipe  #shorts #recipe Corn Chat | Healthy Corn Chat Recipe.#corn #cornchaatrecipe #cornsnacks #cornrecipe #shorts #recipe
    January 29, 2026
    Let’s try this healthy snacks part -2 #shortsfeed #shorts #recipe Let’s try this healthy snacks part -2 #shortsfeed #shorts #recipe
    January 29, 2026
    4 Easy and Tasty Greek Yogurt Snack Ideas 4 Easy and Tasty Greek Yogurt Snack Ideas
    January 29, 2026
    Healthy Snacks for Kids | Easy & Quick Indian Healthy Snacks Recipes | No Junk Food Healthy Snacks for Kids | Easy & Quick Indian Healthy Snacks Recipes | No Junk Food
    January 29, 2026
    5 Minutes Easy Suji Breakfast Recipe #healthy #shorts #recipe #shortsfeed #suji #snacks 5 Minutes Easy Suji Breakfast Recipe #healthy #shorts #recipe #shortsfeed #suji #snacks
    January 29, 2026
    Previous Next
  • Weight Loss
    healthy breakfast and lunch and dinner recipes #food #cooking #vizagvlogs healthy breakfast and lunch and dinner recipes #food #cooking #vizagvlogs
    January 29, 2026
    details in pinned comments #telugu #food #trending #diet #weightloss #sweet details in pinned comments #telugu #food #trending #diet #weightloss #sweet
    January 29, 2026
    Protein Jello for Sweet Cravings | High Protein Low Calorie Dessert Protein Jello for Sweet Cravings | High Protein Low Calorie Dessert
    January 28, 2026
    Healthy weight loss salad #food #vairalvideo #tamilshorts #shorts Healthy weight loss salad #food #vairalvideo #tamilshorts #shorts
    January 28, 2026
    Dhaniya Pancake Recipe | Healthy Breakfast | Quick & Easy#corianderdosa#shorts #healthy #weightloss Dhaniya Pancake Recipe | Healthy Breakfast | Quick & Easy#corianderdosa#shorts #healthy #weightloss
    January 28, 2026
    Previous Next
  • Low Calorie
    Healthy Malai Broccoli | 20g protein | Weight loss Friendly Healthy Malai Broccoli | 20g protein | Weight loss Friendly
    January 29, 2026
    Delicious LOW CARB & LOW CALORIE Dinner - EASY, CHEAP and HEALTHY (Skillet Only) Delicious LOW CARB & LOW CALORIE Dinner – EASY, CHEAP and HEALTHY (Skillet Only)
    January 26, 2026
    Low-Calorie High-Protein Lemon Chicken Bowl (Perfect Meal Prep Lunch) Low-Calorie High-Protein Lemon Chicken Bowl (Perfect Meal Prep Lunch)
    January 26, 2026
    I ate this daily and lost 75lbs I ate this daily and lost 75lbs
    January 26, 2026
    Do THIS After Eating to LOWER Blood Sugar INSTANTLY Do THIS After Eating to LOWER Blood Sugar INSTANTLY
    January 26, 2026
    Previous Next
  • Salad
    Crispy Air Fryer Quinoa Salad | High Protein Chickpea Salad Recipe | Easy Healthy Lunch Crispy Air Fryer Quinoa Salad | High Protein Chickpea Salad Recipe | Easy Healthy Lunch
    January 29, 2026
    Healthy salad recipe#recipe Healthy salad recipe#recipe
    January 29, 2026
    5 Minute Salad for Gut Health, Weight Loss & Energy | Healthy Eating Habits #salad #saladdressing 5 Minute Salad for Gut Health, Weight Loss & Energy | Healthy Eating Habits #salad #saladdressing
    January 27, 2026
    Easy Veggie Utpam for Husband's Tiffin | Lunch Box Recipes #TiffinStories. #youtubeshorts #food Easy Veggie Utpam for Husband’s Tiffin | Lunch Box Recipes #TiffinStories. #youtubeshorts #food
    January 27, 2026
    Salad A Day Challenge | Day 8 #recipe #salad #healthyfood Salad A Day Challenge | Day 8 #recipe #salad #healthyfood
    January 27, 2026
    Previous Next
  • Bread
    healthy bread toast recipe#food #cookingshorts #recipe#trending @sawariyaapnafood #indianbread ... healthy bread toast recipe#food #cookingshorts #recipe#trending @sawariyaapnafood #indianbread …
    January 29, 2026
    Fast & Fluffy Homemade Bread | Simple Pantry Ingredients#crispyoutside #softinside #perfectbread Fast & Fluffy Homemade Bread | Simple Pantry Ingredients#crispyoutside #softinside #perfectbread
    January 26, 2026
    3 Healthy Bread Machine Recipes | Simple Low Effort Baking #shorts 3 Healthy Bread Machine Recipes | Simple Low Effort Baking #shorts
    January 25, 2026
    egg bread with veggies#healthy#tasty#food#cooking#recipe#new#easy#egg#bread#yt#shorts#youtubeshorts egg bread with veggies#healthy#tasty#food#cooking#recipe#new#easy#egg#bread#yt#shorts#youtubeshorts
    January 24, 2026
    Minute Easy Bread Egg Toast Recipe | Quick & Healthy Breakfast#shortsfeed #shortvideo #recipe Minute Easy Bread Egg Toast Recipe | Quick & Healthy Breakfast#shortsfeed #shortvideo #recipe
    January 24, 2026
    Previous Next
  • Sandwich
    Episode Z- Zero prep sandwich ideas Episode Z- Zero prep sandwich ideas
    January 29, 2026
    Healthy Veg Sandwich | Easy & Creamy Veg Sandwich Recipe#HealthySandwich #VegSandwich #viral Healthy Veg Sandwich | Easy & Creamy Veg Sandwich Recipe#HealthySandwich #VegSandwich #viral
    January 29, 2026
    Let's Make *Ekdum healthy SANDWICH*#food #trendingshorts #homemade #youtubeshorts #recipe #cooking Let’s Make *Ekdum healthy SANDWICH*#food #trendingshorts #homemade #youtubeshorts #recipe #cooking
    January 29, 2026
    Healthy Poha Recipe #shorts Healthy Poha Recipe #shorts
    January 29, 2026
    5 minutes healthy and easy vegetable sandwich #sandwichrecipe #shortsviral #shortsfeed #shortvideo 5 minutes healthy and easy vegetable sandwich #sandwichrecipe #shortsviral #shortsfeed #shortvideo
    January 29, 2026
    Previous Next
How to make a healthy salad | Sprouted green gram salad with Mustard microgreens  #shorts  #magudi
Salad

How to make a healthy salad | Sprouted green gram salad with Mustard microgreens #shorts #magudi

By UCOOK February 17, 2023

Foxtail millet with purple sweet potato powder puttu –
#healthylifestyle #ytshorts #trending #diy #shorts

#farmshop#fingermillet#milletsfarm#milletsfarmcentre#milletsnacks#ragibenefitsamazonproductBreakfastbreakfastrecipecookingCOVIDCuisineeasytomakesaladeathealthyFarmFLOWERSfoodfoodbloggerfoodiefoodphotographyfoodpornGogreenGramGreenGreengramhealthyHealthy CuisineHealthy Ideashealthy recipeshealthy saladHealthy Salad IdeasHealthy Salad RecipeshealthycookinghealthylifestylehealthylivinghealthyrecipeshomemadehowtomakesaladideasindianfoodmagudiMicrogreensmilletsmilletsfoodsMustardnutritionorganicrecipesaladSalad Ideassalad recipessaladmakingshortssorghumsouthindianfoodSproutedstayfitsupportlocalveganVideoVlogYouTube

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.