UCOOK: Healthy Ideas
  • Recipes
    5-Min Instant Mooli Pickle | (Pickled Radish)  #shorts #thecha #healthyrecipes #instantachaar 5-Min Instant Mooli Pickle | (Pickled Radish) #shorts #thecha #healthyrecipes #instantachaar
    April 30, 2026
    Kovakkai Poriyal | Tasty & Healthy recipes  #auslinhealthybites Kovakkai Poriyal | Tasty & Healthy recipes #auslinhealthybites
    April 29, 2026
    HOT HONEY CHICKEN COTTAGE CHEESE PIZZA TOAST #cottagecheese #pizzatoast #healthyrecipes #highprotein HOT HONEY CHICKEN COTTAGE CHEESE PIZZA TOAST #cottagecheese #pizzatoast #healthyrecipes #highprotein
    April 29, 2026
    Healthy Recipes||Dry fruits laddo||#shorts Healthy Recipes||Dry fruits laddo||#shorts
    April 29, 2026
    Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer
    April 29, 2026
    Previous Next
  • Breakfast
    10 Minutes Instant Breakfast Recipes #shorts #shortvideo #youtubeshorts #ytshorts 10 Minutes Instant Breakfast Recipes #shorts #shortvideo #youtubeshorts #ytshorts
    April 30, 2026
    healthy breakfast ideas over night otas recipe #shorts#trending #food #healthy #otas healthy breakfast ideas over night otas recipe #shorts#trending #food #healthy #otas
    April 30, 2026
    Perfect Soft Idli Recipe | Healthy Breakfast in 10 Min idly Chutney #trending #viral #shortsfeed Perfect Soft Idli Recipe | Healthy Breakfast in 10 Min idly Chutney #trending #viral #shortsfeed
    April 30, 2026
    3 ingredients. 10-minute breakfast recipe. Fast and healthy breakfast recipe. How to make sandwiches 3 ingredients. 10-minute breakfast recipe. Fast and healthy breakfast recipe. How to make sandwiches
    April 30, 2026
    High Protein Recipes # 2 | Healthy Breakfast/Dinner Recipes | Protein Rich Recipes | Hostel Recipes High Protein Recipes # 2 | Healthy Breakfast/Dinner Recipes | Protein Rich Recipes | Hostel Recipes
    April 30, 2026
    Previous Next
  • Lunch
    Day 03 - Healthy Lunch Ideas | Indian Lunch Thali #healthylunch #balancedmeals #highproteinmeals Day 03 – Healthy Lunch Ideas | Indian Lunch Thali #healthylunch #balancedmeals #highproteinmeals
    April 30, 2026
    Kurangi gula pasir, tepung dan nasi putih #defisitkalori #menudietharian #shorts Kurangi gula pasir, tepung dan nasi putih #defisitkalori #menudietharian #shorts
    April 30, 2026
    High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner's Recipe | Easy Hostel Recipes High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner’s Recipe | Easy Hostel Recipes
    April 29, 2026
    Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania
    April 29, 2026
    This Is Why Your Night Meals Are Slowing Your WeightLoss #zeeliciousfoods #insulin #healthyeating This Is Why Your Night Meals Are Slowing Your WeightLoss #zeeliciousfoods #insulin #healthyeating
    April 29, 2026
    Previous Next
  • Dinner
    Dr Subhash Goyal’s SECRET Benefits of Moong Dal | Protein Moong Dal Recipe! #shorts Dr Subhash Goyal’s SECRET Benefits of Moong Dal | Protein Moong Dal Recipe! #shorts
    April 30, 2026
    Body Cooling Drink for Summer| Healthy Desi Drink#foodie#food #foodshorts#recipe #cooking#easyrecipe Body Cooling Drink for Summer| Healthy Desi Drink#foodie#food #foodshorts#recipe #cooking#easyrecipe
    April 30, 2026
    weekend VLOG: mental health chat, my glute workout, healthy dinner recipes + updated spring makeup weekend VLOG: mental health chat, my glute workout, healthy dinner recipes + updated spring makeup
    April 29, 2026
    @DTHshow On YouTube:  Healthy Dinner Ideas: Steak, Shrimp, & Cod Tacos! @DTHshow On YouTube: Healthy Dinner Ideas: Steak, Shrimp, & Cod Tacos!
    April 29, 2026
    Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes
    April 29, 2026
    Previous Next
  • Snacks
    #trending #viralshort#viralshorts #roastedchana #protinshake#healthy #healthymilk #trending #viralshort#viralshorts #roastedchana #protinshake#healthy #healthymilk
    April 30, 2026
    Healthy & Easy Recipe | Crispy Thalipeeth | #shorts #shortfeed  #viral  #recipe #food #healthy Healthy & Easy Recipe | Crispy Thalipeeth | #shorts #shortfeed #viral #recipe #food #healthy
    April 30, 2026
    Jhal Muri recipe ...#kitchen#cooking#shorts#healthy#snacks#recipe ..! Jhal Muri recipe …#kitchen#cooking#shorts#healthy#snacks#recipe ..!
    April 29, 2026
    Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice
    April 29, 2026
    today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral
    April 29, 2026
    Previous Next
  • Weight Loss
    HelloFresh vs Factor 75 | Best for Weight Loss, Muscle Gain, and Healthy Living in 2026 HelloFresh vs Factor 75 | Best for Weight Loss, Muscle Gain, and Healthy Living in 2026
    April 30, 2026
    This was bussin #explore #yogurtbowl #healthy #weightloss This was bussin #explore #yogurtbowl #healthy #weightloss
    April 30, 2026
    High-Protein Soup Premix | 10-Min Quick Healthy Dinner | Weight Loss Friendly Recipe High-Protein Soup Premix | 10-Min Quick Healthy Dinner | Weight Loss Friendly Recipe
    April 30, 2026
    Cucumber kimchi salad recipe |weight-loss recipe| Cucumber kimchi salad recipe |weight-loss recipe|
    April 29, 2026
    WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule
    April 29, 2026
    Previous Next
  • Low Calorie
    BBQ Bacon Potato Bowls High Protein Meal Prep Recipe #shorts BBQ Bacon Potato Bowls High Protein Meal Prep Recipe #shorts
    April 29, 2026
    How I Make Diet Food Taste Good #diettips #fatloss #fatlosstips How I Make Diet Food Taste Good #diettips #fatloss #fatlosstips
    April 29, 2026
    Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes
    April 29, 2026
    5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet 5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet
    April 29, 2026
    #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss #weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss
    April 29, 2026
    Previous Next
  • Salad
    Chicken and beetroot salad / healthy salad recipe /salad recipes#healthylifestyle #salad Chicken and beetroot salad / healthy salad recipe /salad recipes#healthylifestyle #salad
    April 29, 2026
    healthy morning breakfast #salad #breakfast #snacks #sprouts #homemadefood #viralcookingshorts #yt healthy morning breakfast #salad #breakfast #snacks #sprouts #homemadefood #viralcookingshorts #yt
    April 29, 2026
    Dr.Subhash Goyal said the right time to eat cucumber #cucumber #cucumbersalad#cucumberbenefits#salad Dr.Subhash Goyal said the right time to eat cucumber #cucumber #cucumbersalad#cucumberbenefits#salad
    April 29, 2026
    Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts
    April 29, 2026
    5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad 5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad
    April 29, 2026
    Previous Next
  • Bread
    High Protein Bread Puffs Recipe | No frying No Maida | 10g per puff High Protein Bread Puffs Recipe | No frying No Maida | 10g per puff
    April 30, 2026
    Healthy Banana Bread Recipe! #healthylifestyle #healthydessertrecipe #bananabreadrecipe #dessert Healthy Banana Bread Recipe! #healthylifestyle #healthydessertrecipe #bananabreadrecipe #dessert
    April 30, 2026
    10 minute Bread pizza recipe.Amul diced cheese bread recipe #breadpizza#breadrecipes#cheesepizza 10 minute Bread pizza recipe.Amul diced cheese bread recipe #breadpizza#breadrecipes#cheesepizza
    April 30, 2026
    cast iron is my favorite thing to cook/bake with! Lodge makes it so easy because it comes cast iron is my favorite thing to cook/bake with! Lodge makes it so easy because it comes
    April 29, 2026
    Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts
    April 29, 2026
    Previous Next
  • Sandwich
    Honey Banana Sandwich Recipe | Easy Breakfast Recipe |  instant Breakfast Recipe Honey Banana Sandwich Recipe | Easy Breakfast Recipe | instant Breakfast Recipe
    April 30, 2026
    Protein sandwich #food #recipe #cooking #reels #foodie #love #relationship #fyp #babifreitas #shorts Protein sandwich #food #recipe #cooking #reels #foodie #love #relationship #fyp #babifreitas #shorts
    April 30, 2026
    Healthy mayonnaise sandwich #lunchboxrecipes #lunchbox #homemademayonnaiserecipe #shorts #shortsfeed Healthy mayonnaise sandwich #lunchboxrecipes #lunchbox #homemademayonnaiserecipe #shorts #shortsfeed
    April 30, 2026
    grill sandwich recipe #healthy sandwich for weight loss recipe #shorts grill sandwich recipe #healthy sandwich for weight loss recipe #shorts
    April 30, 2026
    Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs
    April 29, 2026
    Previous Next
Healthy Sandwich At Home|Daily Breakfast|#homemade #yummy #recipe #shorts
Sandwich

Healthy Sandwich At Home|Daily Breakfast|#homemade #yummy #recipe #shorts

By UCOOK February 22, 2025

#BakingForBeginners#easycookingrecipes#QuickCookingTipsbakingtipsBreadMakingAtHomebreakfasthomemadecakerecipescookingforbeginnerscookinghacksCuisinehealthyHealthy CuisineHealthy Ideashealthy recipesHealthy SandwichHealthy Sandwich IdeasHealthy Sandwich RecipeshomecookinghomedailyHomemadeBakingideasquickandeasymealsrecipesandwichsandwich ideassandwich recipesshortsVideoVlogYouTubeYummy

    © ucook.org

    Top

      Type above and press Enter to search. Press Esc to cancel.