Recipes
5-Min Instant Mooli Pickle | (Pickled Radish) #shorts #thecha #healthyrecipes #instantachaar
April 30, 2026
Kovakkai Poriyal | Tasty & Healthy recipes #auslinhealthybites
April 29, 2026
HOT HONEY CHICKEN COTTAGE CHEESE PIZZA TOAST #cottagecheese #pizzatoast #healthyrecipes #highprotein
April 29, 2026
Healthy Recipes||Dry fruits laddo||#shorts
April 29, 2026
Muskmelon Seed Shake | Simple & Nutritious Drink #healthy #hack #diy #summer
April 29, 2026
Previous Next
Breakfast
10 Minutes Instant Breakfast Recipes #shorts #shortvideo #youtubeshorts #ytshorts
April 30, 2026
healthy breakfast ideas over night otas recipe #shorts#trending #food #healthy #otas
April 30, 2026
Perfect Soft Idli Recipe | Healthy Breakfast in 10 Min idly Chutney #trending #viral #shortsfeed
April 30, 2026
3 ingredients. 10-minute breakfast recipe. Fast and healthy breakfast recipe. How to make sandwiches
April 30, 2026
High Protein Recipes # 2 | Healthy Breakfast/Dinner Recipes | Protein Rich Recipes | Hostel Recipes
April 30, 2026
Previous Next
Lunch
Day 03 – Healthy Lunch Ideas | Indian Lunch Thali #healthylunch #balancedmeals #highproteinmeals
April 30, 2026
Kurangi gula pasir, tepung dan nasi putih #defisitkalori #menudietharian #shorts
April 30, 2026
High Protein Recipes #1 | Healthy Breakfast/Dinner Recipes | Beginner’s Recipe | Easy Hostel Recipes
April 29, 2026
Simple Healthy Lunch Recipe For Summer Season #trending #viral #shortsfeed #shorts #recipe #vegmania
April 29, 2026
This Is Why Your Night Meals Are Slowing Your WeightLoss #zeeliciousfoods #insulin #healthyeating
April 29, 2026
Previous Next
Dinner
Dr Subhash Goyal’s SECRET Benefits of Moong Dal | Protein Moong Dal Recipe! #shorts
April 30, 2026
Body Cooling Drink for Summer| Healthy Desi Drink#foodie#food #foodshorts#recipe #cooking#easyrecipe
April 30, 2026
weekend VLOG: mental health chat, my glute workout, healthy dinner recipes + updated spring makeup
April 29, 2026
@DTHshow On YouTube: Healthy Dinner Ideas: Steak, Shrimp, & Cod Tacos!
April 29, 2026
Easy healthy skillet dinner recipe #dinnerrecipe #easyrecipes
April 29, 2026
Previous Next
Snacks
#trending #viralshort#viralshorts #roastedchana #protinshake#healthy #healthymilk
April 30, 2026
Healthy & Easy Recipe | Crispy Thalipeeth | #shorts #shortfeed #viral #recipe #food #healthy
April 30, 2026
Jhal Muri recipe …#kitchen#cooking#shorts#healthy#snacks#recipe ..!
April 29, 2026
Murmura Namkeen Recipe | Puffed Rice Snack #shorts #murmurarecipe #namkeen #snacks #puffedrice
April 29, 2026
today healthy evening snacks#recipe #tasty #tamil #shorts #cooking #food #trending #yt#viral
April 29, 2026
Previous Next
Weight Loss
HelloFresh vs Factor 75 | Best for Weight Loss, Muscle Gain, and Healthy Living in 2026
April 30, 2026
This was bussin #explore #yogurtbowl #healthy #weightloss
April 30, 2026
High-Protein Soup Premix | 10-Min Quick Healthy Dinner | Weight Loss Friendly Recipe
April 30, 2026
Cucumber kimchi salad recipe |weight-loss recipe|
April 29, 2026
WFPB Corn Chowder for Weight Loss #easydinner #leftoversrule
April 29, 2026
Previous Next
Low Calorie
BBQ Bacon Potato Bowls High Protein Meal Prep Recipe #shorts
April 29, 2026
How I Make Diet Food Taste Good #diettips #fatloss #fatlosstips
April 29, 2026
Lost 4 KG in a Month! 5 Healthy, Low Calorie and High Protein Chia Pudding Recipes
April 29, 2026
5-Min High Protein Paneer Bowl with Creamy Cucumber Carrot Salad | Weight Loss & PCOS Diet
April 29, 2026
#weightloss #oatsupma #healthybreakfast #dietfood #fitness #healthylifestyle #oatsrecipe #fatloss
April 29, 2026
Previous Next
Salad
Chicken and beetroot salad / healthy salad recipe /salad recipes#healthylifestyle #salad
April 29, 2026
healthy morning breakfast #salad #breakfast #snacks #sprouts #homemadefood #viralcookingshorts #yt
April 29, 2026
Dr.Subhash Goyal said the right time to eat cucumber #cucumber #cucumbersalad#cucumberbenefits#salad
April 29, 2026
Pijuli Salad Recipe | Pijuli Salada | Healthy Guava Salad | Summer Special Easy Recipe #shorts
April 29, 2026
5-Minute Fruit Salad Recipe | Easy Healthy Snack You’ll Love#easy#recipe#healthy#fruit#salad
April 29, 2026
Previous Next
Bread
High Protein Bread Puffs Recipe | No frying No Maida | 10g per puff
April 30, 2026
Healthy Banana Bread Recipe! #healthylifestyle #healthydessertrecipe #bananabreadrecipe #dessert
April 30, 2026
10 minute Bread pizza recipe.Amul diced cheese bread recipe #breadpizza#breadrecipes#cheesepizza
April 30, 2026
cast iron is my favorite thing to cook/bake with! Lodge makes it so easy because it comes
April 29, 2026
Evening snacks #baccho le lunch box ke liye #healthy #simplesnack #shorts#ytshorts
April 29, 2026
Previous Next
Sandwich
Honey Banana Sandwich Recipe | Easy Breakfast Recipe | instant Breakfast Recipe
April 30, 2026
Protein sandwich #food #recipe #cooking #reels #foodie #love #relationship #fyp #babifreitas #shorts
April 30, 2026
Healthy mayonnaise sandwich #lunchboxrecipes #lunchbox #homemademayonnaiserecipe #shorts #shortsfeed
April 30, 2026
grill sandwich recipe #healthy sandwich for weight loss recipe #shorts
April 30, 2026
Street Style Sandwhich Recipe On Tawa #shorts #sandwich #eatdelicious #chotaalivlogs
April 29, 2026
Previous Next

chicken Keema recipe #cookingvideo#ramadan#recipe#easyrecipe#healthyrecipes#easyrecipeswithfarha

chicken Keema recipe #cookingvideo#ramadan#recipe#easyrecipe#healthyrecipes#easyrecipeswithfarha

By UCOOK March 18, 2026

chicken cookingvideoramadanrecipeeasyrecipehealthyrecipeseasyrecipeswithfarha Cuisine healthy Healthy Cuisine healthy recipes KEEMA recipe Video Vlog YouTube

Type above and press Enter to search. Press Esc to cancel.